Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7N9Q6

Protein Details
Accession A0A1B7N9Q6    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
188-215PTDIPPVTTKRPRGRPKGSKNRVGKAGGHydrophilic
NLS Segment(s)
PositionSequence
197-213KRPRGRPKGSKNRVGKA
Subcellular Location(s) nucl 22.5, cyto_nucl 16, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000637  HMGI/Y_DNA-bd_CS  
IPR018482  Znf-C4H2  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MYQQFSVASSSDYAPHATTTTSAATAAAPKSQPLVATGDWTTELVQLAKTAELKKHSLTLQLHTANIVAAHNTLEQKDKAIQDIKEQKNRLDSERVRLLNALAEINADRDKVDLLEASITRECADLRQQIQTLQDGEYAVAKRDVDRLRVELGQPPLPPLQTKLDEKTSQYLRDRRVTGEKRTVTDSPTDIPPVTTKRPRGRPKGSKNRVGKAGGNAASGSASATAGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.14
5 0.14
6 0.14
7 0.14
8 0.13
9 0.12
10 0.11
11 0.12
12 0.15
13 0.15
14 0.16
15 0.15
16 0.15
17 0.17
18 0.18
19 0.17
20 0.15
21 0.18
22 0.15
23 0.18
24 0.18
25 0.17
26 0.17
27 0.17
28 0.15
29 0.12
30 0.13
31 0.1
32 0.1
33 0.1
34 0.1
35 0.11
36 0.14
37 0.15
38 0.18
39 0.21
40 0.23
41 0.23
42 0.27
43 0.26
44 0.31
45 0.3
46 0.3
47 0.34
48 0.33
49 0.32
50 0.28
51 0.27
52 0.19
53 0.18
54 0.14
55 0.07
56 0.06
57 0.07
58 0.08
59 0.09
60 0.1
61 0.12
62 0.12
63 0.14
64 0.18
65 0.17
66 0.2
67 0.24
68 0.23
69 0.29
70 0.39
71 0.44
72 0.48
73 0.48
74 0.46
75 0.48
76 0.5
77 0.44
78 0.44
79 0.39
80 0.38
81 0.44
82 0.43
83 0.36
84 0.34
85 0.31
86 0.23
87 0.22
88 0.15
89 0.08
90 0.08
91 0.07
92 0.08
93 0.08
94 0.07
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.04
101 0.04
102 0.06
103 0.06
104 0.08
105 0.08
106 0.08
107 0.08
108 0.09
109 0.08
110 0.08
111 0.12
112 0.13
113 0.15
114 0.17
115 0.17
116 0.18
117 0.2
118 0.2
119 0.17
120 0.14
121 0.13
122 0.11
123 0.11
124 0.12
125 0.11
126 0.11
127 0.11
128 0.1
129 0.1
130 0.17
131 0.19
132 0.19
133 0.21
134 0.22
135 0.23
136 0.25
137 0.25
138 0.23
139 0.25
140 0.24
141 0.23
142 0.23
143 0.22
144 0.21
145 0.21
146 0.19
147 0.21
148 0.23
149 0.26
150 0.28
151 0.33
152 0.34
153 0.36
154 0.4
155 0.38
156 0.4
157 0.44
158 0.47
159 0.46
160 0.51
161 0.5
162 0.48
163 0.55
164 0.55
165 0.55
166 0.58
167 0.56
168 0.51
169 0.55
170 0.51
171 0.43
172 0.4
173 0.35
174 0.28
175 0.27
176 0.27
177 0.22
178 0.22
179 0.25
180 0.27
181 0.34
182 0.38
183 0.45
184 0.52
185 0.63
186 0.72
187 0.77
188 0.83
189 0.85
190 0.89
191 0.91
192 0.91
193 0.9
194 0.89
195 0.87
196 0.83
197 0.76
198 0.69
199 0.64
200 0.64
201 0.55
202 0.48
203 0.39
204 0.33
205 0.28
206 0.23
207 0.17
208 0.09
209 0.07