Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MGV0

Protein Details
Accession A0A1B7MGV0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-38RSLPRCPSLSRCPRPHRHYPYLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPQRESQPALHVRPLRSLPRCPSLSRCPRPHRHYPYLPLRLHHLHRGPRPPHLHPHLHLRYPLLHLSSCHSLMQTALFPFRNAAYRVRRDRRACDASQCACFCVRLPRHEIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.5
4 0.54
5 0.52
6 0.55
7 0.56
8 0.53
9 0.55
10 0.56
11 0.62
12 0.64
13 0.68
14 0.7
15 0.77
16 0.81
17 0.85
18 0.84
19 0.82
20 0.79
21 0.78
22 0.78
23 0.77
24 0.71
25 0.61
26 0.57
27 0.53
28 0.5
29 0.47
30 0.43
31 0.41
32 0.45
33 0.54
34 0.5
35 0.52
36 0.55
37 0.51
38 0.53
39 0.52
40 0.5
41 0.42
42 0.51
43 0.46
44 0.43
45 0.4
46 0.33
47 0.29
48 0.28
49 0.28
50 0.19
51 0.16
52 0.14
53 0.17
54 0.19
55 0.18
56 0.16
57 0.14
58 0.13
59 0.13
60 0.14
61 0.12
62 0.1
63 0.12
64 0.12
65 0.12
66 0.13
67 0.14
68 0.17
69 0.17
70 0.24
71 0.29
72 0.38
73 0.48
74 0.55
75 0.63
76 0.65
77 0.69
78 0.72
79 0.71
80 0.64
81 0.62
82 0.63
83 0.58
84 0.6
85 0.54
86 0.46
87 0.39
88 0.37
89 0.31
90 0.33
91 0.35
92 0.34