Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MLE7

Protein Details
Accession A0A1B7MLE7   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
158-185RPVLCSKAKQGKEKERDRREARKERDETBasic
NLS Segment(s)
PositionSequence
166-180KQGKEKERDRREARK
Subcellular Location(s) cyto 16.5, cyto_nucl 11.5, nucl 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Amino Acid Sequences EDEPVDIDEPWTLSYVPITKDIVSPEAHVRLRRQAQAWRGVTALSPPPTNPHRTQIQSVPPAPSPSQLHTNPLVRPPTYSLHTTVPVPSSSYIAPFTCAITPSASYLADPLNAYAHLGMPKPFVHLMGPPLDVALDARVVGDEGRFARNGCRPNAVLRPVLCSKAKQGKEKERDRREARKERDETDGVDDTLTFGVFALRDLKANEEVVLGWEWDDGNAVHSLPALI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.17
4 0.19
5 0.2
6 0.2
7 0.22
8 0.24
9 0.24
10 0.21
11 0.22
12 0.23
13 0.29
14 0.31
15 0.33
16 0.34
17 0.4
18 0.45
19 0.48
20 0.47
21 0.47
22 0.51
23 0.57
24 0.55
25 0.47
26 0.41
27 0.37
28 0.33
29 0.29
30 0.28
31 0.21
32 0.2
33 0.19
34 0.25
35 0.29
36 0.35
37 0.34
38 0.33
39 0.38
40 0.41
41 0.45
42 0.46
43 0.5
44 0.5
45 0.49
46 0.47
47 0.41
48 0.41
49 0.37
50 0.36
51 0.3
52 0.26
53 0.31
54 0.29
55 0.31
56 0.32
57 0.35
58 0.32
59 0.35
60 0.35
61 0.28
62 0.29
63 0.28
64 0.27
65 0.26
66 0.27
67 0.24
68 0.23
69 0.24
70 0.23
71 0.21
72 0.19
73 0.16
74 0.16
75 0.13
76 0.13
77 0.11
78 0.12
79 0.12
80 0.11
81 0.12
82 0.11
83 0.11
84 0.1
85 0.11
86 0.1
87 0.09
88 0.1
89 0.09
90 0.1
91 0.09
92 0.08
93 0.08
94 0.08
95 0.08
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.05
102 0.06
103 0.06
104 0.07
105 0.07
106 0.08
107 0.09
108 0.11
109 0.1
110 0.1
111 0.1
112 0.1
113 0.11
114 0.12
115 0.12
116 0.1
117 0.1
118 0.09
119 0.08
120 0.07
121 0.06
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.07
131 0.08
132 0.09
133 0.09
134 0.13
135 0.18
136 0.23
137 0.22
138 0.25
139 0.25
140 0.3
141 0.36
142 0.34
143 0.33
144 0.3
145 0.34
146 0.32
147 0.35
148 0.31
149 0.27
150 0.31
151 0.37
152 0.42
153 0.45
154 0.53
155 0.59
156 0.68
157 0.77
158 0.8
159 0.8
160 0.84
161 0.84
162 0.85
163 0.85
164 0.86
165 0.84
166 0.84
167 0.79
168 0.71
169 0.7
170 0.62
171 0.53
172 0.49
173 0.43
174 0.32
175 0.28
176 0.25
177 0.19
178 0.17
179 0.14
180 0.08
181 0.05
182 0.06
183 0.06
184 0.07
185 0.1
186 0.1
187 0.12
188 0.13
189 0.16
190 0.18
191 0.19
192 0.18
193 0.15
194 0.15
195 0.15
196 0.16
197 0.12
198 0.1
199 0.1
200 0.1
201 0.09
202 0.1
203 0.08
204 0.09
205 0.1
206 0.1
207 0.09