Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R7R1

Protein Details
Accession C4R7R1   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
218-239RDPLAKRKSRFERKQQLLTKKDBasic
NLS Segment(s)
PositionSequence
307-310RKKR
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008991  Translation_prot_SH3-like_sf  
KEGG ppa:PAS_chr4_0956  -  
Amino Acid Sequences MSRLLKESKRYGANMKRLHPLVKAHFDNINRKGQIPAVRNDLPAVREEKQFKSLEDWKYTVGDKVMIVKGALKGTVTSIIRTQKETNGFMLEDGPTKEVVIPPNYWLQSESSHVVEYPKVVTSEYFKLVGTIKDETSGESRQIAANDVVFRGKYWDEDYKKMMPYRCIKNKEEYIIPWPRPDKPEDDKFCTEEAVALERTYEPVSIFESDIPSDLNLRDPLAKRKSRFERKQQLLTKKDLKLLQSPAMPYSDTKKAFFRERAEIRSKQITEMSAEVADFIGKRVADHLNKIKDPYMWQYIKKVSGDRKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.66
3 0.66
4 0.64
5 0.62
6 0.57
7 0.55
8 0.53
9 0.55
10 0.53
11 0.48
12 0.5
13 0.53
14 0.58
15 0.55
16 0.56
17 0.48
18 0.46
19 0.45
20 0.45
21 0.47
22 0.43
23 0.42
24 0.41
25 0.42
26 0.42
27 0.42
28 0.38
29 0.31
30 0.29
31 0.3
32 0.25
33 0.29
34 0.33
35 0.35
36 0.39
37 0.39
38 0.37
39 0.4
40 0.44
41 0.44
42 0.45
43 0.43
44 0.38
45 0.39
46 0.39
47 0.33
48 0.26
49 0.21
50 0.16
51 0.2
52 0.2
53 0.18
54 0.17
55 0.17
56 0.19
57 0.18
58 0.18
59 0.12
60 0.11
61 0.12
62 0.18
63 0.16
64 0.15
65 0.19
66 0.25
67 0.26
68 0.3
69 0.31
70 0.3
71 0.35
72 0.35
73 0.32
74 0.28
75 0.27
76 0.23
77 0.22
78 0.18
79 0.15
80 0.14
81 0.13
82 0.11
83 0.11
84 0.11
85 0.12
86 0.15
87 0.15
88 0.15
89 0.16
90 0.22
91 0.22
92 0.21
93 0.2
94 0.18
95 0.17
96 0.19
97 0.19
98 0.14
99 0.14
100 0.14
101 0.14
102 0.13
103 0.12
104 0.11
105 0.1
106 0.09
107 0.09
108 0.1
109 0.13
110 0.15
111 0.16
112 0.16
113 0.14
114 0.15
115 0.16
116 0.17
117 0.15
118 0.14
119 0.12
120 0.13
121 0.13
122 0.13
123 0.15
124 0.15
125 0.13
126 0.12
127 0.12
128 0.12
129 0.12
130 0.12
131 0.1
132 0.1
133 0.1
134 0.1
135 0.1
136 0.09
137 0.08
138 0.09
139 0.09
140 0.08
141 0.11
142 0.19
143 0.21
144 0.24
145 0.28
146 0.29
147 0.32
148 0.34
149 0.33
150 0.32
151 0.36
152 0.44
153 0.49
154 0.52
155 0.51
156 0.54
157 0.55
158 0.52
159 0.47
160 0.39
161 0.38
162 0.39
163 0.37
164 0.35
165 0.33
166 0.34
167 0.34
168 0.35
169 0.34
170 0.34
171 0.43
172 0.45
173 0.5
174 0.48
175 0.48
176 0.46
177 0.39
178 0.32
179 0.24
180 0.18
181 0.14
182 0.13
183 0.11
184 0.11
185 0.1
186 0.12
187 0.1
188 0.1
189 0.07
190 0.08
191 0.1
192 0.11
193 0.11
194 0.11
195 0.11
196 0.11
197 0.11
198 0.11
199 0.09
200 0.09
201 0.09
202 0.11
203 0.1
204 0.11
205 0.16
206 0.19
207 0.28
208 0.35
209 0.42
210 0.42
211 0.51
212 0.61
213 0.67
214 0.74
215 0.76
216 0.78
217 0.79
218 0.87
219 0.86
220 0.85
221 0.79
222 0.77
223 0.75
224 0.67
225 0.65
226 0.58
227 0.52
228 0.49
229 0.49
230 0.45
231 0.4
232 0.38
233 0.33
234 0.31
235 0.29
236 0.23
237 0.24
238 0.27
239 0.27
240 0.27
241 0.31
242 0.35
243 0.42
244 0.47
245 0.47
246 0.5
247 0.54
248 0.59
249 0.62
250 0.6
251 0.58
252 0.61
253 0.56
254 0.49
255 0.45
256 0.39
257 0.35
258 0.32
259 0.28
260 0.2
261 0.19
262 0.16
263 0.13
264 0.13
265 0.1
266 0.09
267 0.1
268 0.1
269 0.1
270 0.14
271 0.22
272 0.24
273 0.33
274 0.41
275 0.46
276 0.48
277 0.51
278 0.5
279 0.45
280 0.47
281 0.45
282 0.46
283 0.43
284 0.44
285 0.49
286 0.52
287 0.55
288 0.54
289 0.55
290 0.55