Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7NDB5

Protein Details
Accession A0A1B7NDB5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-23HTNHNQTRKAHRNGIRRPQTNHydrophilic
NLS Segment(s)
PositionSequence
18-20RRP
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences KSHTNHNQTRKAHRNGIRRPQTNRSRSSRGVDPKFRKNSLYALNGSRKARAEQKASTTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.82
4 0.82
5 0.78
6 0.77
7 0.78
8 0.8
9 0.77
10 0.74
11 0.7
12 0.67
13 0.63
14 0.61
15 0.59
16 0.58
17 0.58
18 0.6
19 0.59
20 0.62
21 0.65
22 0.62
23 0.56
24 0.49
25 0.48
26 0.45
27 0.43
28 0.37
29 0.38
30 0.43
31 0.47
32 0.46
33 0.44
34 0.39
35 0.39
36 0.44
37 0.45
38 0.44
39 0.44