Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7N6R6

Protein Details
Accession A0A1B7N6R6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
28-48ILCPWHKPPRDKNKARRSAGAHydrophilic
NLS Segment(s)
PositionSequence
35-47PPRDKNKARRSAG
Subcellular Location(s) cyto 15, cyto_nucl 11.5, nucl 6, mito 3
Family & Domain DBs
Amino Acid Sequences MDDFEHLASLEDENDYGECRCPRDLPGILCPWHKPPRDKNKARRSAGAGRAIRNFAVQFVGELVERDMEKAAPLLCFRTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.13
5 0.14
6 0.16
7 0.18
8 0.18
9 0.2
10 0.26
11 0.29
12 0.28
13 0.32
14 0.34
15 0.34
16 0.35
17 0.34
18 0.35
19 0.38
20 0.4
21 0.41
22 0.47
23 0.56
24 0.66
25 0.74
26 0.77
27 0.8
28 0.85
29 0.81
30 0.74
31 0.7
32 0.67
33 0.64
34 0.62
35 0.54
36 0.47
37 0.46
38 0.43
39 0.37
40 0.3
41 0.24
42 0.15
43 0.14
44 0.11
45 0.09
46 0.08
47 0.09
48 0.08
49 0.08
50 0.08
51 0.09
52 0.09
53 0.1
54 0.1
55 0.09
56 0.1
57 0.11
58 0.12
59 0.12
60 0.14