Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MLM0

Protein Details
Accession A0A1B7MLM0   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
105-127SIPMRSSKKTGAKSKKEVREKVQHydrophilic
NLS Segment(s)
PositionSequence
113-120KTGAKSKK
Subcellular Location(s) nucl 11cyto 11cyto_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR015034  Bles03  
IPR023398  TIF_eIF4e-like  
Pfam View protein in Pfam  
PF08939  DUF1917  
Amino Acid Sequences MGKESDDAIPQEYPYYWTEGSSVVLSDFLTKYKPSMVQNDGTKPWIWVKGSSPKRDSDALGAAAATSEAAALLKEVSQRIEEIKASGRSSDIYCLSSTASQNDDSIPMRSSKKTGAKSKKEVREKVQADAAEKLKDISIKHKYVCGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.17
4 0.17
5 0.17
6 0.17
7 0.18
8 0.15
9 0.14
10 0.09
11 0.09
12 0.09
13 0.11
14 0.1
15 0.1
16 0.11
17 0.11
18 0.12
19 0.15
20 0.2
21 0.21
22 0.27
23 0.3
24 0.35
25 0.39
26 0.43
27 0.41
28 0.38
29 0.35
30 0.29
31 0.28
32 0.26
33 0.23
34 0.2
35 0.23
36 0.32
37 0.39
38 0.44
39 0.43
40 0.41
41 0.43
42 0.43
43 0.39
44 0.31
45 0.26
46 0.2
47 0.18
48 0.16
49 0.12
50 0.1
51 0.09
52 0.06
53 0.03
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.04
62 0.05
63 0.06
64 0.06
65 0.07
66 0.08
67 0.09
68 0.09
69 0.09
70 0.14
71 0.16
72 0.16
73 0.15
74 0.15
75 0.15
76 0.15
77 0.17
78 0.14
79 0.13
80 0.12
81 0.13
82 0.13
83 0.14
84 0.14
85 0.13
86 0.14
87 0.13
88 0.13
89 0.13
90 0.15
91 0.14
92 0.14
93 0.14
94 0.16
95 0.18
96 0.19
97 0.21
98 0.27
99 0.34
100 0.41
101 0.5
102 0.58
103 0.64
104 0.73
105 0.8
106 0.83
107 0.84
108 0.83
109 0.79
110 0.79
111 0.72
112 0.66
113 0.62
114 0.54
115 0.47
116 0.46
117 0.42
118 0.33
119 0.31
120 0.27
121 0.23
122 0.24
123 0.23
124 0.26
125 0.32
126 0.36
127 0.38