Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7MQ64

Protein Details
Accession A0A1B7MQ64    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
225-244REEVKFGPASRKKSNNRYFMHydrophilic
NLS Segment(s)
PositionSequence
98-115RSRRFRTAKEAREVREKA
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027073  5_3_exoribonuclease  
IPR004859  Xrn1_N  
Gene Ontology GO:0004534  F:5'-3' RNA exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03159  XRN_N  
CDD cd18673  PIN_XRN1-2-like  
Amino Acid Sequences MGIPKFFRYISERYPLTSQLIEENKIPEFDNLYLDFNGIIHNCSHPNDEDAHFRMSEEQIYTAIFAYVDLLFGKIKPKKLFFMAVDGVAPRAKMNQQRSRRFRTAKEAREVREKAESKGEKLPAEKAFDSNCITPGTPFMARLSEQLRYFVNKKISEDSNWRGVQVVLSGHEVPGEGEHKIMEYIRLSRAQPDYNPNIRHCLYGLDADLIMLGLLSHDPHFCLLREEVKFGPASRKKSNNRYFMDFVHRSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.4
4 0.34
5 0.29
6 0.29
7 0.32
8 0.3
9 0.29
10 0.29
11 0.26
12 0.26
13 0.27
14 0.2
15 0.2
16 0.19
17 0.21
18 0.2
19 0.22
20 0.21
21 0.2
22 0.18
23 0.14
24 0.16
25 0.12
26 0.12
27 0.1
28 0.12
29 0.14
30 0.16
31 0.19
32 0.17
33 0.19
34 0.21
35 0.23
36 0.26
37 0.27
38 0.27
39 0.24
40 0.23
41 0.24
42 0.22
43 0.22
44 0.17
45 0.15
46 0.13
47 0.13
48 0.13
49 0.11
50 0.1
51 0.07
52 0.06
53 0.07
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.16
61 0.18
62 0.25
63 0.29
64 0.31
65 0.34
66 0.37
67 0.42
68 0.35
69 0.38
70 0.32
71 0.28
72 0.26
73 0.22
74 0.2
75 0.15
76 0.14
77 0.08
78 0.08
79 0.13
80 0.19
81 0.28
82 0.37
83 0.46
84 0.57
85 0.64
86 0.71
87 0.75
88 0.73
89 0.67
90 0.69
91 0.69
92 0.65
93 0.67
94 0.64
95 0.58
96 0.62
97 0.59
98 0.5
99 0.49
100 0.44
101 0.36
102 0.4
103 0.38
104 0.32
105 0.36
106 0.37
107 0.29
108 0.29
109 0.33
110 0.26
111 0.29
112 0.26
113 0.22
114 0.2
115 0.21
116 0.22
117 0.17
118 0.16
119 0.14
120 0.13
121 0.12
122 0.12
123 0.13
124 0.11
125 0.11
126 0.1
127 0.11
128 0.11
129 0.13
130 0.14
131 0.15
132 0.15
133 0.16
134 0.17
135 0.19
136 0.21
137 0.24
138 0.29
139 0.26
140 0.28
141 0.31
142 0.33
143 0.32
144 0.37
145 0.35
146 0.37
147 0.35
148 0.33
149 0.29
150 0.27
151 0.24
152 0.18
153 0.15
154 0.09
155 0.11
156 0.11
157 0.1
158 0.1
159 0.1
160 0.09
161 0.1
162 0.1
163 0.07
164 0.07
165 0.07
166 0.08
167 0.08
168 0.09
169 0.09
170 0.09
171 0.12
172 0.15
173 0.18
174 0.18
175 0.23
176 0.26
177 0.27
178 0.29
179 0.34
180 0.4
181 0.44
182 0.49
183 0.45
184 0.47
185 0.45
186 0.43
187 0.35
188 0.3
189 0.23
190 0.21
191 0.21
192 0.16
193 0.15
194 0.13
195 0.13
196 0.1
197 0.08
198 0.05
199 0.04
200 0.03
201 0.03
202 0.05
203 0.06
204 0.06
205 0.07
206 0.09
207 0.11
208 0.11
209 0.15
210 0.17
211 0.24
212 0.25
213 0.29
214 0.28
215 0.29
216 0.3
217 0.28
218 0.36
219 0.35
220 0.41
221 0.46
222 0.56
223 0.63
224 0.72
225 0.8
226 0.79
227 0.78
228 0.79
229 0.74
230 0.69
231 0.69