Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NB94

Protein Details
Accession A0A1B7NB94   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
538-562MASASKGKKKLTKKKAKAKAAGSEAHydrophilic
564-619DDEEKPKKAVPKPKAKPKVKKQDDDAMDVDEDEKPKPKPKPKPKAKLKASSPKEGEBasic
NLS Segment(s)
PositionSequence
542-584SKGKKKLTKKKAKAKAAGSEAGDDEEKPKKAVPKPKAKPKVKK
597-630KPKPKPKPKPKAKLKASSPKEGEEGEPAKKKPKI
Subcellular Location(s) cyto 15.5, cyto_nucl 13.666, nucl 9.5, cyto_mito 9.499, mito_nucl 6.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR001772  KA1_dom  
IPR011993  PH-like_dom_sf  
IPR013719  RTT106/SPT16-like_middle_dom  
IPR000969  SSRP1/POB3  
IPR035417  SSRP1/POB3_N  
IPR024954  SSRP1_DD  
IPR038167  SSRP1_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF17292  POB3_N  
PF08512  Rtt106  
PF03531  SSrecog  
PROSITE View protein in PROSITE  
PS50032  KA1  
CDD cd13230  PH1_SSRP1-like  
cd13231  PH2_SSRP1-like  
Amino Acid Sequences MATTQFDKIYHGLSFEVGKFRVAASGMAWKGEENEGVTALPSADIKWAQWYRVARNFQLRVGLKDRRRETFDGFLREDHDKLAGLLKQHFGVTLEVKDVTFKGWNWGVTDIQGQDLAFLVSNKTAFELPLSQVANSNIAGRTEVSLEFAAATSSGKKASRSAPDEMVEIRFYVPGTQPRIRGSDAGSQKSDDEGEGEVEEMSAAQAFHDAIKDKAEIGQVSGDLVLSFEEVLILTPRGRYDVDMFLDFLRLRGKTYDYKILYSSISRLFLLPKDDQHVLFILGLSTPIRQGQTRYSYLVMQFAREEETTAELNMAEEDIEKYDRLKKNYEDPTFEVVSGVFRALSKKKIISLGSFKSRDGHPGIKANLKAVQGDLFMLEKYIFFVSKQPTLIEISDIHQCVFSRVGASMGATAARTFDLKIVTKSGPEYTFTSINKEEHEPVEAYLKDKKVKLKNEMVPDVDMLAVGADSSDDEMQSVASSGDERPKPRLGGDDDEDSEEVVDEDFQASSTDEGSPSESDSDDDGGVTASDASGDREMASASKGKKKLTKKKAKAKAAGSEAGDDEEKPKKAVPKPKAKPKVKKQDDDAMDVDEDEKPKPKPKPKPKAKLKASSPKEGEEGEPAKKKPKISSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.24
4 0.22
5 0.22
6 0.21
7 0.2
8 0.21
9 0.19
10 0.16
11 0.13
12 0.21
13 0.21
14 0.21
15 0.21
16 0.19
17 0.2
18 0.21
19 0.21
20 0.14
21 0.14
22 0.14
23 0.14
24 0.14
25 0.12
26 0.1
27 0.1
28 0.08
29 0.08
30 0.11
31 0.12
32 0.12
33 0.21
34 0.23
35 0.23
36 0.29
37 0.34
38 0.39
39 0.47
40 0.52
41 0.48
42 0.56
43 0.58
44 0.54
45 0.58
46 0.52
47 0.49
48 0.51
49 0.55
50 0.51
51 0.58
52 0.62
53 0.59
54 0.63
55 0.61
56 0.6
57 0.6
58 0.61
59 0.59
60 0.55
61 0.5
62 0.47
63 0.45
64 0.4
65 0.31
66 0.25
67 0.18
68 0.17
69 0.21
70 0.19
71 0.19
72 0.21
73 0.22
74 0.22
75 0.22
76 0.22
77 0.18
78 0.19
79 0.19
80 0.17
81 0.17
82 0.16
83 0.16
84 0.17
85 0.16
86 0.15
87 0.16
88 0.15
89 0.19
90 0.22
91 0.23
92 0.24
93 0.26
94 0.24
95 0.22
96 0.25
97 0.19
98 0.16
99 0.16
100 0.14
101 0.12
102 0.12
103 0.1
104 0.08
105 0.08
106 0.08
107 0.08
108 0.09
109 0.09
110 0.1
111 0.1
112 0.09
113 0.11
114 0.13
115 0.13
116 0.19
117 0.19
118 0.18
119 0.2
120 0.21
121 0.21
122 0.18
123 0.2
124 0.14
125 0.14
126 0.15
127 0.12
128 0.13
129 0.12
130 0.12
131 0.12
132 0.11
133 0.11
134 0.1
135 0.1
136 0.09
137 0.07
138 0.08
139 0.07
140 0.08
141 0.11
142 0.12
143 0.13
144 0.17
145 0.23
146 0.31
147 0.35
148 0.38
149 0.39
150 0.39
151 0.39
152 0.37
153 0.32
154 0.24
155 0.2
156 0.16
157 0.12
158 0.11
159 0.12
160 0.14
161 0.18
162 0.25
163 0.28
164 0.3
165 0.32
166 0.35
167 0.34
168 0.32
169 0.3
170 0.31
171 0.34
172 0.35
173 0.34
174 0.31
175 0.3
176 0.29
177 0.26
178 0.17
179 0.13
180 0.09
181 0.09
182 0.08
183 0.08
184 0.07
185 0.07
186 0.06
187 0.05
188 0.04
189 0.04
190 0.04
191 0.03
192 0.04
193 0.05
194 0.05
195 0.07
196 0.08
197 0.08
198 0.1
199 0.1
200 0.1
201 0.12
202 0.14
203 0.12
204 0.12
205 0.12
206 0.1
207 0.1
208 0.1
209 0.08
210 0.05
211 0.05
212 0.04
213 0.04
214 0.04
215 0.03
216 0.03
217 0.03
218 0.04
219 0.05
220 0.05
221 0.06
222 0.06
223 0.07
224 0.09
225 0.09
226 0.1
227 0.12
228 0.16
229 0.17
230 0.17
231 0.18
232 0.16
233 0.18
234 0.16
235 0.14
236 0.13
237 0.11
238 0.11
239 0.12
240 0.16
241 0.19
242 0.23
243 0.31
244 0.3
245 0.31
246 0.3
247 0.3
248 0.28
249 0.23
250 0.22
251 0.15
252 0.15
253 0.14
254 0.14
255 0.14
256 0.14
257 0.18
258 0.17
259 0.16
260 0.18
261 0.19
262 0.19
263 0.18
264 0.17
265 0.13
266 0.12
267 0.11
268 0.07
269 0.06
270 0.06
271 0.05
272 0.05
273 0.05
274 0.06
275 0.07
276 0.08
277 0.1
278 0.15
279 0.2
280 0.21
281 0.22
282 0.22
283 0.23
284 0.23
285 0.26
286 0.21
287 0.16
288 0.15
289 0.14
290 0.15
291 0.13
292 0.13
293 0.08
294 0.1
295 0.1
296 0.09
297 0.09
298 0.07
299 0.07
300 0.06
301 0.06
302 0.03
303 0.03
304 0.04
305 0.04
306 0.05
307 0.05
308 0.07
309 0.15
310 0.19
311 0.21
312 0.25
313 0.26
314 0.35
315 0.44
316 0.46
317 0.41
318 0.41
319 0.42
320 0.39
321 0.37
322 0.28
323 0.19
324 0.16
325 0.13
326 0.1
327 0.05
328 0.05
329 0.09
330 0.1
331 0.14
332 0.15
333 0.16
334 0.18
335 0.22
336 0.23
337 0.24
338 0.29
339 0.31
340 0.36
341 0.36
342 0.34
343 0.33
344 0.32
345 0.31
346 0.29
347 0.28
348 0.23
349 0.27
350 0.29
351 0.31
352 0.31
353 0.29
354 0.29
355 0.26
356 0.23
357 0.18
358 0.17
359 0.12
360 0.12
361 0.11
362 0.07
363 0.06
364 0.07
365 0.06
366 0.05
367 0.06
368 0.07
369 0.06
370 0.06
371 0.12
372 0.14
373 0.17
374 0.18
375 0.17
376 0.18
377 0.2
378 0.19
379 0.16
380 0.14
381 0.13
382 0.16
383 0.16
384 0.15
385 0.14
386 0.14
387 0.13
388 0.13
389 0.12
390 0.09
391 0.09
392 0.09
393 0.08
394 0.08
395 0.07
396 0.06
397 0.06
398 0.06
399 0.05
400 0.05
401 0.06
402 0.06
403 0.06
404 0.07
405 0.11
406 0.12
407 0.14
408 0.17
409 0.17
410 0.18
411 0.19
412 0.21
413 0.18
414 0.19
415 0.21
416 0.2
417 0.25
418 0.24
419 0.28
420 0.27
421 0.27
422 0.27
423 0.27
424 0.26
425 0.22
426 0.24
427 0.2
428 0.18
429 0.23
430 0.2
431 0.2
432 0.23
433 0.25
434 0.27
435 0.3
436 0.38
437 0.41
438 0.48
439 0.54
440 0.58
441 0.61
442 0.65
443 0.66
444 0.59
445 0.51
446 0.44
447 0.36
448 0.26
449 0.19
450 0.11
451 0.07
452 0.05
453 0.03
454 0.03
455 0.02
456 0.03
457 0.04
458 0.05
459 0.04
460 0.05
461 0.05
462 0.05
463 0.05
464 0.06
465 0.04
466 0.04
467 0.06
468 0.07
469 0.15
470 0.19
471 0.21
472 0.26
473 0.29
474 0.3
475 0.3
476 0.36
477 0.33
478 0.36
479 0.37
480 0.37
481 0.35
482 0.36
483 0.34
484 0.27
485 0.22
486 0.16
487 0.12
488 0.08
489 0.06
490 0.05
491 0.05
492 0.05
493 0.06
494 0.06
495 0.07
496 0.07
497 0.08
498 0.08
499 0.08
500 0.09
501 0.11
502 0.11
503 0.11
504 0.12
505 0.11
506 0.12
507 0.13
508 0.13
509 0.11
510 0.11
511 0.09
512 0.08
513 0.08
514 0.07
515 0.06
516 0.04
517 0.05
518 0.05
519 0.07
520 0.08
521 0.08
522 0.08
523 0.09
524 0.09
525 0.09
526 0.11
527 0.15
528 0.19
529 0.27
530 0.31
531 0.37
532 0.45
533 0.55
534 0.64
535 0.7
536 0.77
537 0.79
538 0.86
539 0.91
540 0.93
541 0.91
542 0.87
543 0.85
544 0.8
545 0.74
546 0.64
547 0.56
548 0.46
549 0.39
550 0.33
551 0.24
552 0.21
553 0.23
554 0.23
555 0.22
556 0.25
557 0.31
558 0.39
559 0.49
560 0.55
561 0.6
562 0.7
563 0.8
564 0.87
565 0.89
566 0.92
567 0.93
568 0.94
569 0.93
570 0.91
571 0.87
572 0.86
573 0.8
574 0.75
575 0.65
576 0.56
577 0.46
578 0.38
579 0.32
580 0.25
581 0.22
582 0.19
583 0.22
584 0.23
585 0.32
586 0.41
587 0.5
588 0.58
589 0.68
590 0.78
591 0.84
592 0.91
593 0.94
594 0.95
595 0.95
596 0.94
597 0.93
598 0.93
599 0.88
600 0.87
601 0.8
602 0.72
603 0.65
604 0.57
605 0.48
606 0.46
607 0.44
608 0.42
609 0.45
610 0.44
611 0.5
612 0.52
613 0.55