Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NF51

Protein Details
Accession A0A1B7NF51    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-48GMLPHWPPQKTKKGKEKAYQPYQQYPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012816  NADAR  
IPR037238  YbiA-like_sf  
Pfam View protein in Pfam  
PF08719  NADAR  
CDD cd15457  NADAR  
Amino Acid Sequences MGAGSSKHAAYPFPVPSVGPNGMLPHWPPQKTKKGKEKAYQPYQQYPSGFPPVAYGVQYYPQMQPGYPQVSSYYPPVTMVPIQQPMVGMPQPYVPVQNVAPAPVIPFAAPSAGPQRMPEPPTTNNQASAPVIPNATPAYSQPPPVIPDLAAQSGPGVPPPPIITDTPRAADLSSRPRFTNFYRPADPPVYMPEPHVTDIPYRPPTVPPDRTLQRNPLPSPPRDIWETTPYRQVLRELPKDITLSLNVEHMEELENMLAQPAGSTSRLGGLFGSSKRSGKTRKGLFRAFSTSGSENESGRRHHRSNTVTSFVIPAAAAIPHGTNPGAQPGAPQPMPSPERGPPIKFNHTGELSGFVNHSPHRVLYKNKMYPTAMHLLEAMKFTAHPDIQERIRICKDVGDMYPLSASFQQYVRPDWGQVFLNTMEDVLYLKFKQHPTLRTLLLNTGGSDVVYADNNTYWGEGPSGTGSNELGNALVRVRDRLRADGDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.26
4 0.31
5 0.29
6 0.24
7 0.22
8 0.23
9 0.23
10 0.26
11 0.25
12 0.28
13 0.34
14 0.36
15 0.42
16 0.49
17 0.58
18 0.66
19 0.74
20 0.76
21 0.78
22 0.85
23 0.87
24 0.88
25 0.88
26 0.88
27 0.86
28 0.82
29 0.81
30 0.76
31 0.72
32 0.63
33 0.56
34 0.52
35 0.51
36 0.45
37 0.35
38 0.32
39 0.31
40 0.3
41 0.26
42 0.22
43 0.16
44 0.19
45 0.21
46 0.21
47 0.19
48 0.23
49 0.23
50 0.21
51 0.23
52 0.27
53 0.3
54 0.27
55 0.27
56 0.24
57 0.26
58 0.28
59 0.28
60 0.23
61 0.18
62 0.19
63 0.19
64 0.2
65 0.19
66 0.21
67 0.23
68 0.24
69 0.24
70 0.24
71 0.23
72 0.21
73 0.23
74 0.21
75 0.16
76 0.13
77 0.15
78 0.16
79 0.16
80 0.17
81 0.14
82 0.15
83 0.15
84 0.19
85 0.18
86 0.17
87 0.17
88 0.15
89 0.16
90 0.14
91 0.14
92 0.09
93 0.09
94 0.08
95 0.09
96 0.09
97 0.09
98 0.14
99 0.15
100 0.16
101 0.16
102 0.19
103 0.24
104 0.26
105 0.29
106 0.28
107 0.3
108 0.36
109 0.42
110 0.4
111 0.36
112 0.34
113 0.32
114 0.28
115 0.28
116 0.24
117 0.18
118 0.17
119 0.15
120 0.16
121 0.15
122 0.14
123 0.12
124 0.1
125 0.16
126 0.16
127 0.18
128 0.17
129 0.19
130 0.2
131 0.21
132 0.21
133 0.15
134 0.16
135 0.17
136 0.17
137 0.15
138 0.12
139 0.11
140 0.11
141 0.11
142 0.09
143 0.08
144 0.07
145 0.08
146 0.09
147 0.1
148 0.12
149 0.13
150 0.16
151 0.2
152 0.22
153 0.22
154 0.21
155 0.2
156 0.18
157 0.18
158 0.2
159 0.25
160 0.28
161 0.29
162 0.29
163 0.31
164 0.34
165 0.36
166 0.42
167 0.39
168 0.41
169 0.43
170 0.44
171 0.47
172 0.46
173 0.42
174 0.32
175 0.3
176 0.27
177 0.23
178 0.23
179 0.21
180 0.2
181 0.21
182 0.2
183 0.16
184 0.16
185 0.17
186 0.22
187 0.22
188 0.21
189 0.21
190 0.23
191 0.28
192 0.34
193 0.35
194 0.31
195 0.37
196 0.39
197 0.44
198 0.45
199 0.46
200 0.43
201 0.46
202 0.45
203 0.47
204 0.48
205 0.43
206 0.46
207 0.4
208 0.37
209 0.33
210 0.33
211 0.28
212 0.31
213 0.34
214 0.29
215 0.33
216 0.32
217 0.3
218 0.29
219 0.28
220 0.26
221 0.3
222 0.33
223 0.3
224 0.3
225 0.31
226 0.3
227 0.29
228 0.22
229 0.15
230 0.12
231 0.1
232 0.1
233 0.09
234 0.09
235 0.08
236 0.07
237 0.08
238 0.07
239 0.07
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.03
246 0.03
247 0.03
248 0.04
249 0.05
250 0.05
251 0.05
252 0.08
253 0.08
254 0.08
255 0.08
256 0.08
257 0.11
258 0.11
259 0.16
260 0.14
261 0.16
262 0.17
263 0.23
264 0.27
265 0.32
266 0.4
267 0.44
268 0.52
269 0.58
270 0.61
271 0.58
272 0.56
273 0.55
274 0.48
275 0.4
276 0.35
277 0.29
278 0.25
279 0.26
280 0.24
281 0.18
282 0.2
283 0.21
284 0.21
285 0.25
286 0.31
287 0.29
288 0.33
289 0.4
290 0.41
291 0.47
292 0.49
293 0.48
294 0.41
295 0.39
296 0.36
297 0.28
298 0.23
299 0.15
300 0.1
301 0.07
302 0.06
303 0.06
304 0.05
305 0.05
306 0.05
307 0.06
308 0.06
309 0.06
310 0.07
311 0.1
312 0.09
313 0.09
314 0.1
315 0.13
316 0.18
317 0.17
318 0.17
319 0.16
320 0.23
321 0.25
322 0.25
323 0.26
324 0.24
325 0.32
326 0.35
327 0.37
328 0.38
329 0.43
330 0.49
331 0.49
332 0.48
333 0.46
334 0.44
335 0.41
336 0.34
337 0.3
338 0.23
339 0.2
340 0.18
341 0.13
342 0.14
343 0.13
344 0.15
345 0.12
346 0.14
347 0.17
348 0.21
349 0.27
350 0.34
351 0.44
352 0.49
353 0.5
354 0.53
355 0.5
356 0.48
357 0.47
358 0.45
359 0.34
360 0.28
361 0.27
362 0.23
363 0.23
364 0.22
365 0.17
366 0.1
367 0.1
368 0.11
369 0.15
370 0.14
371 0.14
372 0.17
373 0.22
374 0.24
375 0.31
376 0.31
377 0.32
378 0.35
379 0.35
380 0.31
381 0.3
382 0.3
383 0.28
384 0.28
385 0.26
386 0.24
387 0.23
388 0.24
389 0.2
390 0.2
391 0.17
392 0.17
393 0.14
394 0.15
395 0.19
396 0.2
397 0.24
398 0.27
399 0.26
400 0.26
401 0.25
402 0.28
403 0.26
404 0.24
405 0.24
406 0.19
407 0.19
408 0.17
409 0.16
410 0.13
411 0.1
412 0.11
413 0.08
414 0.11
415 0.1
416 0.13
417 0.2
418 0.22
419 0.31
420 0.37
421 0.41
422 0.43
423 0.49
424 0.5
425 0.47
426 0.48
427 0.42
428 0.39
429 0.35
430 0.3
431 0.25
432 0.21
433 0.17
434 0.15
435 0.12
436 0.1
437 0.1
438 0.1
439 0.1
440 0.1
441 0.11
442 0.11
443 0.12
444 0.11
445 0.11
446 0.11
447 0.1
448 0.12
449 0.14
450 0.15
451 0.14
452 0.15
453 0.14
454 0.14
455 0.14
456 0.13
457 0.1
458 0.1
459 0.1
460 0.1
461 0.13
462 0.13
463 0.19
464 0.21
465 0.28
466 0.3
467 0.35