Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MYH5

Protein Details
Accession A0A1B7MYH5   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
47-76HLELWTKMDPKKKRKRKKRTTIRTVRGIYABasic
NLS Segment(s)
PositionSequence
56-66PKKKRKRKKRT
Subcellular Location(s) mito 13, mito_nucl 11.333, cyto_nucl 7.666, nucl 7.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MLRALSTTIRHTHRSQHLLHRWLTYIERPTETADCRGPYAVVRAFGHLELWTKMDPKKKRKRKKRTTIRTVRGIYADGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.56
4 0.6
5 0.6
6 0.61
7 0.53
8 0.45
9 0.42
10 0.39
11 0.33
12 0.3
13 0.27
14 0.26
15 0.25
16 0.26
17 0.27
18 0.26
19 0.24
20 0.21
21 0.2
22 0.19
23 0.18
24 0.16
25 0.13
26 0.15
27 0.13
28 0.13
29 0.13
30 0.14
31 0.14
32 0.14
33 0.14
34 0.11
35 0.12
36 0.1
37 0.11
38 0.11
39 0.13
40 0.17
41 0.25
42 0.33
43 0.43
44 0.53
45 0.63
46 0.73
47 0.82
48 0.9
49 0.93
50 0.95
51 0.96
52 0.96
53 0.96
54 0.96
55 0.94
56 0.92
57 0.85
58 0.77
59 0.67