Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MTZ7

Protein Details
Accession A0A1B7MTZ7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
128-152VSKDERTHGRHYRRSTKGKRVSSAQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MIAVAFVFFANHTNRELARNYTTFAFQSSSTAVAFCKISHDVKRAAICLYERELLNLSVITQTISSMSSPTSPEPTASFHYSLQQTSTGWHEPKKLKRIDSERNEKLHAAFVLNMMDWRLISLTSSEVSKDERTHGRHYRRSTKGKRVSSAQELTLCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.26
4 0.27
5 0.3
6 0.29
7 0.3
8 0.29
9 0.29
10 0.26
11 0.25
12 0.21
13 0.15
14 0.16
15 0.15
16 0.15
17 0.13
18 0.13
19 0.11
20 0.11
21 0.12
22 0.1
23 0.12
24 0.14
25 0.19
26 0.23
27 0.27
28 0.28
29 0.32
30 0.34
31 0.31
32 0.28
33 0.26
34 0.22
35 0.21
36 0.21
37 0.2
38 0.18
39 0.18
40 0.19
41 0.17
42 0.16
43 0.13
44 0.11
45 0.08
46 0.08
47 0.07
48 0.05
49 0.05
50 0.05
51 0.06
52 0.05
53 0.05
54 0.06
55 0.06
56 0.08
57 0.09
58 0.11
59 0.11
60 0.12
61 0.12
62 0.15
63 0.17
64 0.18
65 0.19
66 0.16
67 0.19
68 0.2
69 0.19
70 0.17
71 0.14
72 0.12
73 0.12
74 0.15
75 0.16
76 0.16
77 0.18
78 0.24
79 0.3
80 0.37
81 0.45
82 0.46
83 0.45
84 0.52
85 0.59
86 0.62
87 0.65
88 0.68
89 0.65
90 0.64
91 0.62
92 0.55
93 0.47
94 0.4
95 0.31
96 0.22
97 0.16
98 0.14
99 0.13
100 0.12
101 0.12
102 0.09
103 0.08
104 0.07
105 0.07
106 0.06
107 0.05
108 0.06
109 0.06
110 0.07
111 0.08
112 0.09
113 0.09
114 0.1
115 0.13
116 0.15
117 0.16
118 0.21
119 0.28
120 0.32
121 0.41
122 0.49
123 0.56
124 0.62
125 0.69
126 0.74
127 0.77
128 0.83
129 0.84
130 0.85
131 0.85
132 0.85
133 0.82
134 0.79
135 0.77
136 0.75
137 0.69
138 0.62