Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NDX1

Protein Details
Accession A0A1B7NDX1    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-59VLPNRRTSRRGRNHAKQEHRPVBasic
78-102ALGMQSTPRKKRQSNNREKRRSALLHydrophilic
NLS Segment(s)
PositionSequence
18-54RRRFPIFGKKKTRVAGGHKAVLPNRRTSRRGRNHAKQ
85-98PRKKRQSNNREKRR
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MNLFQTNERERDHTSSARRRFPIFGKKKTRVAGGHKAVLPNRRTSRRGRNHAKQEHRPVGNLGSGETHLPFMTKVKRALGMQSTPRKKRQSNNREKRRSALL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.59
4 0.63
5 0.62
6 0.59
7 0.59
8 0.6
9 0.61
10 0.61
11 0.64
12 0.65
13 0.69
14 0.72
15 0.7
16 0.68
17 0.64
18 0.62
19 0.62
20 0.57
21 0.55
22 0.5
23 0.5
24 0.47
25 0.47
26 0.41
27 0.39
28 0.41
29 0.43
30 0.45
31 0.49
32 0.56
33 0.6
34 0.68
35 0.69
36 0.71
37 0.76
38 0.82
39 0.83
40 0.8
41 0.79
42 0.77
43 0.68
44 0.6
45 0.51
46 0.43
47 0.36
48 0.28
49 0.19
50 0.12
51 0.12
52 0.11
53 0.1
54 0.09
55 0.07
56 0.08
57 0.08
58 0.11
59 0.16
60 0.2
61 0.22
62 0.23
63 0.27
64 0.27
65 0.32
66 0.34
67 0.35
68 0.4
69 0.48
70 0.56
71 0.59
72 0.66
73 0.7
74 0.71
75 0.75
76 0.77
77 0.78
78 0.8
79 0.85
80 0.88
81 0.9
82 0.87