Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZH14

Protein Details
Accession C7ZH14    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
462-487MVAPKLEGWRRKRKLAEEKQALRSKLHydrophilic
NLS Segment(s)
PositionSequence
470-480WRRKRKLAEEK
Subcellular Location(s) pero 8, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR000960  Flavin_mOase  
IPR020946  Flavin_mOase-like  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0004499  F:N,N-dimethylaniline monooxygenase activity  
GO:0050661  F:NADP binding  
KEGG nhe:NECHADRAFT_51830  -  
Pfam View protein in Pfam  
PF00743  FMO-like  
Amino Acid Sequences MPSQIRRVAVIGAGPAGAIATDALVKEGAFDTIRVFDRRAGVGGTWIHTPHLPAGIPSLKKVLAGDADTAVPIPENLPAVTTVSEAVNSHQYRFSDTAIHENLHSNITPAIMSFTQEPFPDKLSQRSLDEYGPNAPFRHHTTIREWIEGIFSRGGHEKLLELDTTVERAVKENGEWVLTLRKVVNGRNYWWRETFDALVVASGHYNVPWFPEVTGLIEFDKRFPGVVQHSKHFREGPKYTGKRVIVVGASVSSHEIIHEILDFTEGPVYASIRGDPIPAFGWEPFTHPKIAIKPAISRLDPETGKVHFTDGTQLDKVDHIIYGTGYTFSFPFLPEVQSRVKNAYRRLPGVYQHTWNIEDPTLTFVGMLGGGFTFRAYEWQAVAVARTLSGRAKPLPSVPEQLEWERKRVAEKKGGKDYYSIAPDYDKYLEFLRDIAGEPAQGTNGRTLPPFDPKWLEIWAGMVAPKLEGWRRKRKLAEEKQALRSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.06
5 0.05
6 0.04
7 0.04
8 0.05
9 0.05
10 0.06
11 0.07
12 0.07
13 0.08
14 0.09
15 0.11
16 0.1
17 0.1
18 0.11
19 0.16
20 0.21
21 0.21
22 0.22
23 0.24
24 0.27
25 0.28
26 0.28
27 0.25
28 0.21
29 0.24
30 0.25
31 0.23
32 0.21
33 0.2
34 0.2
35 0.19
36 0.2
37 0.17
38 0.18
39 0.16
40 0.15
41 0.21
42 0.26
43 0.26
44 0.26
45 0.28
46 0.24
47 0.25
48 0.25
49 0.22
50 0.19
51 0.19
52 0.19
53 0.17
54 0.17
55 0.16
56 0.16
57 0.13
58 0.09
59 0.08
60 0.07
61 0.07
62 0.08
63 0.08
64 0.09
65 0.09
66 0.11
67 0.11
68 0.11
69 0.1
70 0.09
71 0.1
72 0.1
73 0.11
74 0.19
75 0.19
76 0.21
77 0.23
78 0.23
79 0.27
80 0.29
81 0.28
82 0.25
83 0.25
84 0.31
85 0.3
86 0.3
87 0.26
88 0.27
89 0.27
90 0.23
91 0.22
92 0.15
93 0.13
94 0.13
95 0.12
96 0.09
97 0.12
98 0.1
99 0.11
100 0.12
101 0.13
102 0.15
103 0.16
104 0.19
105 0.17
106 0.2
107 0.25
108 0.25
109 0.29
110 0.33
111 0.35
112 0.34
113 0.37
114 0.36
115 0.33
116 0.33
117 0.28
118 0.28
119 0.28
120 0.27
121 0.23
122 0.22
123 0.22
124 0.27
125 0.33
126 0.31
127 0.32
128 0.35
129 0.45
130 0.46
131 0.45
132 0.39
133 0.31
134 0.31
135 0.28
136 0.26
137 0.17
138 0.14
139 0.14
140 0.17
141 0.17
142 0.14
143 0.13
144 0.11
145 0.12
146 0.14
147 0.12
148 0.09
149 0.11
150 0.11
151 0.11
152 0.11
153 0.1
154 0.09
155 0.11
156 0.12
157 0.11
158 0.1
159 0.13
160 0.13
161 0.12
162 0.12
163 0.11
164 0.14
165 0.14
166 0.15
167 0.12
168 0.15
169 0.17
170 0.2
171 0.27
172 0.26
173 0.29
174 0.37
175 0.4
176 0.4
177 0.4
178 0.39
179 0.32
180 0.32
181 0.29
182 0.2
183 0.18
184 0.14
185 0.13
186 0.1
187 0.09
188 0.07
189 0.06
190 0.05
191 0.04
192 0.05
193 0.05
194 0.06
195 0.07
196 0.07
197 0.07
198 0.08
199 0.08
200 0.1
201 0.1
202 0.09
203 0.09
204 0.11
205 0.11
206 0.1
207 0.11
208 0.1
209 0.09
210 0.09
211 0.12
212 0.17
213 0.25
214 0.26
215 0.3
216 0.36
217 0.37
218 0.39
219 0.39
220 0.34
221 0.35
222 0.35
223 0.36
224 0.41
225 0.42
226 0.42
227 0.45
228 0.42
229 0.36
230 0.34
231 0.3
232 0.2
233 0.18
234 0.15
235 0.09
236 0.08
237 0.07
238 0.07
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.04
248 0.05
249 0.05
250 0.05
251 0.06
252 0.05
253 0.05
254 0.05
255 0.06
256 0.06
257 0.06
258 0.06
259 0.07
260 0.07
261 0.08
262 0.07
263 0.08
264 0.08
265 0.09
266 0.09
267 0.08
268 0.12
269 0.12
270 0.15
271 0.17
272 0.18
273 0.18
274 0.17
275 0.2
276 0.21
277 0.25
278 0.24
279 0.23
280 0.25
281 0.3
282 0.34
283 0.31
284 0.29
285 0.27
286 0.3
287 0.28
288 0.27
289 0.24
290 0.2
291 0.21
292 0.2
293 0.18
294 0.13
295 0.13
296 0.18
297 0.16
298 0.19
299 0.18
300 0.18
301 0.17
302 0.17
303 0.17
304 0.12
305 0.1
306 0.07
307 0.07
308 0.07
309 0.07
310 0.07
311 0.07
312 0.06
313 0.07
314 0.07
315 0.07
316 0.08
317 0.07
318 0.1
319 0.1
320 0.13
321 0.13
322 0.17
323 0.21
324 0.24
325 0.25
326 0.28
327 0.32
328 0.35
329 0.4
330 0.45
331 0.45
332 0.45
333 0.48
334 0.46
335 0.46
336 0.48
337 0.47
338 0.41
339 0.38
340 0.38
341 0.36
342 0.33
343 0.31
344 0.23
345 0.19
346 0.16
347 0.17
348 0.15
349 0.13
350 0.11
351 0.09
352 0.08
353 0.08
354 0.07
355 0.04
356 0.04
357 0.04
358 0.04
359 0.04
360 0.04
361 0.04
362 0.07
363 0.09
364 0.1
365 0.1
366 0.11
367 0.13
368 0.13
369 0.13
370 0.12
371 0.1
372 0.1
373 0.1
374 0.1
375 0.12
376 0.14
377 0.17
378 0.19
379 0.21
380 0.23
381 0.27
382 0.3
383 0.31
384 0.35
385 0.33
386 0.34
387 0.36
388 0.4
389 0.46
390 0.43
391 0.43
392 0.4
393 0.39
394 0.44
395 0.47
396 0.49
397 0.49
398 0.56
399 0.62
400 0.7
401 0.72
402 0.64
403 0.59
404 0.55
405 0.52
406 0.47
407 0.38
408 0.28
409 0.27
410 0.27
411 0.28
412 0.27
413 0.2
414 0.18
415 0.2
416 0.21
417 0.19
418 0.18
419 0.16
420 0.15
421 0.16
422 0.16
423 0.14
424 0.13
425 0.13
426 0.13
427 0.13
428 0.13
429 0.13
430 0.15
431 0.17
432 0.18
433 0.18
434 0.22
435 0.24
436 0.31
437 0.32
438 0.34
439 0.37
440 0.36
441 0.38
442 0.37
443 0.34
444 0.26
445 0.25
446 0.21
447 0.17
448 0.16
449 0.15
450 0.12
451 0.11
452 0.12
453 0.16
454 0.22
455 0.3
456 0.38
457 0.48
458 0.55
459 0.63
460 0.71
461 0.76
462 0.81
463 0.83
464 0.85
465 0.85
466 0.87
467 0.88