Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YPJ4

Protein Details
Accession C7YPJ4   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
237-262ESEVKQPKKPVRKAGKSRASKRKAPABasic
NLS Segment(s)
PositionSequence
241-264KQPKKPVRKAGKSRASKRKAPASK
350-351KK
Subcellular Location(s) nucl 16, mito_nucl 11.833, cyto_nucl 10.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014751  XRCC4-like_C  
KEGG nhe:NECHADRAFT_78775  -  
Amino Acid Sequences MAQTRILRFARSDDKSAFVLVQVTPKGSKPLDLKLVGTEGEAPYVASCKSFHSPPLHRNLQPWVVSLRVKNCPASEDEWQSILEALFQQEPVPDIQATATVQNDKNISITIRKEIQGITQRLGAVTLNYDPDEAIELFEWCGAAVESSAASKQAVADLTVKSADSEAAVTQLQSQLEELLRAKDEDETALLRKFRDLLNEKKVKIREQQQVLASTTFNASMPGQSQRAESVEVKVEESEVKQPKKPVRKAGKSRASKRKAPASKPVEESEEEDVQPMEVDIKQEPEDTDPGNTTEATASVSGDDEDDDAGVLSSSSQQRAVSESAAPQEEAPTQVSQPPPRRELPFALRKKSAKPAPPPAGSDTDSDDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.4
4 0.33
5 0.24
6 0.22
7 0.18
8 0.22
9 0.2
10 0.21
11 0.21
12 0.23
13 0.28
14 0.26
15 0.31
16 0.29
17 0.35
18 0.4
19 0.4
20 0.4
21 0.36
22 0.38
23 0.31
24 0.28
25 0.24
26 0.16
27 0.15
28 0.14
29 0.12
30 0.1
31 0.12
32 0.11
33 0.09
34 0.09
35 0.13
36 0.18
37 0.19
38 0.25
39 0.33
40 0.4
41 0.46
42 0.56
43 0.59
44 0.56
45 0.58
46 0.58
47 0.56
48 0.5
49 0.45
50 0.37
51 0.33
52 0.34
53 0.35
54 0.35
55 0.34
56 0.36
57 0.37
58 0.35
59 0.34
60 0.34
61 0.34
62 0.34
63 0.33
64 0.32
65 0.29
66 0.29
67 0.27
68 0.24
69 0.2
70 0.14
71 0.1
72 0.1
73 0.1
74 0.1
75 0.1
76 0.09
77 0.1
78 0.1
79 0.11
80 0.09
81 0.09
82 0.09
83 0.1
84 0.11
85 0.11
86 0.12
87 0.15
88 0.15
89 0.18
90 0.18
91 0.17
92 0.17
93 0.16
94 0.16
95 0.16
96 0.18
97 0.2
98 0.22
99 0.22
100 0.23
101 0.22
102 0.28
103 0.32
104 0.32
105 0.29
106 0.28
107 0.27
108 0.26
109 0.26
110 0.19
111 0.11
112 0.1
113 0.1
114 0.09
115 0.09
116 0.09
117 0.08
118 0.08
119 0.1
120 0.08
121 0.08
122 0.07
123 0.07
124 0.07
125 0.08
126 0.07
127 0.05
128 0.05
129 0.04
130 0.04
131 0.03
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.05
139 0.05
140 0.06
141 0.06
142 0.07
143 0.09
144 0.09
145 0.1
146 0.1
147 0.1
148 0.08
149 0.08
150 0.07
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.06
158 0.08
159 0.08
160 0.07
161 0.07
162 0.07
163 0.07
164 0.09
165 0.09
166 0.08
167 0.08
168 0.08
169 0.09
170 0.08
171 0.08
172 0.07
173 0.08
174 0.08
175 0.09
176 0.11
177 0.11
178 0.11
179 0.11
180 0.12
181 0.12
182 0.19
183 0.23
184 0.28
185 0.37
186 0.43
187 0.44
188 0.48
189 0.5
190 0.45
191 0.47
192 0.49
193 0.47
194 0.46
195 0.49
196 0.46
197 0.47
198 0.44
199 0.38
200 0.29
201 0.22
202 0.17
203 0.13
204 0.1
205 0.09
206 0.07
207 0.07
208 0.09
209 0.11
210 0.12
211 0.12
212 0.13
213 0.13
214 0.14
215 0.16
216 0.15
217 0.14
218 0.17
219 0.17
220 0.17
221 0.16
222 0.16
223 0.13
224 0.14
225 0.2
226 0.24
227 0.26
228 0.28
229 0.35
230 0.42
231 0.52
232 0.57
233 0.6
234 0.63
235 0.71
236 0.79
237 0.83
238 0.85
239 0.85
240 0.89
241 0.89
242 0.85
243 0.81
244 0.78
245 0.78
246 0.76
247 0.72
248 0.72
249 0.68
250 0.68
251 0.65
252 0.6
253 0.53
254 0.45
255 0.43
256 0.37
257 0.32
258 0.26
259 0.23
260 0.2
261 0.16
262 0.15
263 0.12
264 0.09
265 0.07
266 0.09
267 0.09
268 0.11
269 0.12
270 0.14
271 0.14
272 0.16
273 0.17
274 0.17
275 0.18
276 0.16
277 0.17
278 0.17
279 0.16
280 0.13
281 0.11
282 0.11
283 0.11
284 0.09
285 0.09
286 0.08
287 0.08
288 0.08
289 0.08
290 0.08
291 0.06
292 0.06
293 0.06
294 0.06
295 0.05
296 0.05
297 0.05
298 0.04
299 0.04
300 0.09
301 0.12
302 0.13
303 0.15
304 0.15
305 0.16
306 0.2
307 0.21
308 0.18
309 0.18
310 0.19
311 0.22
312 0.23
313 0.22
314 0.19
315 0.19
316 0.19
317 0.19
318 0.19
319 0.16
320 0.16
321 0.21
322 0.27
323 0.34
324 0.42
325 0.47
326 0.5
327 0.55
328 0.59
329 0.59
330 0.61
331 0.62
332 0.63
333 0.65
334 0.67
335 0.69
336 0.68
337 0.69
338 0.71
339 0.7
340 0.68
341 0.69
342 0.73
343 0.74
344 0.75
345 0.72
346 0.67
347 0.64
348 0.56
349 0.49
350 0.43