Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MGZ1

Protein Details
Accession A0A1B7MGZ1   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
301-322HIGSRFPAPKQRKNPQDARFAVHydrophilic
NLS Segment(s)
PositionSequence
382-397RGRGRGRARGRGGWRG
Subcellular Location(s) mito 17, cyto 6.5, cyto_nucl 5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036866  RibonucZ/Hydroxyglut_hydro  
IPR013471  RNase_Z/BN  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0016891  F:RNA endonuclease activity, producing 5'-phosphomonoesters  
GO:0042779  P:tRNA 3'-trailer cleavage  
CDD cd07717  RNaseZ_ZiPD-like_MBL-fold  
Amino Acid Sequences MARNMNITFLGTSSGGGPSISRNCSSLVVDVIGNGSLWMIDCAEGTLRQFQMQPRGQGDPVLKVPNVAKLFVTHMHADHVMGIITFLRNVLHPPLTSTSGDLSPSNNPPQIELYGPAGLRTFVRSIFTMTLTHTAERYVVHELLTPTDAVTSCDSAVLHSSECLGRDIICDTDGFWRGVTSDTGYWGEVVVDAGPILHRDPCLGYVIHEPDPPRRKLVILGDTFDASPIIPLIQPSLDTPTPVSLLIHEATDSYIARHIDPSARRTKDEVESKVAARGHSTPVMAGTFAKEIGASTLILNHIGSRFPAPKQRKNPQDARFAVIAEIERQASEAWGDGKAVVAHDFMCFSIPAGMSEQHYADMGTMDLEVEGVLEIQAGEMSRGRGRGRARGRGGWRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.11
5 0.15
6 0.21
7 0.23
8 0.23
9 0.24
10 0.25
11 0.28
12 0.29
13 0.25
14 0.2
15 0.19
16 0.17
17 0.17
18 0.15
19 0.13
20 0.11
21 0.09
22 0.07
23 0.05
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.09
31 0.1
32 0.11
33 0.16
34 0.16
35 0.18
36 0.21
37 0.25
38 0.33
39 0.37
40 0.41
41 0.39
42 0.42
43 0.41
44 0.43
45 0.4
46 0.35
47 0.35
48 0.33
49 0.3
50 0.28
51 0.29
52 0.32
53 0.31
54 0.27
55 0.23
56 0.2
57 0.24
58 0.24
59 0.27
60 0.2
61 0.19
62 0.21
63 0.21
64 0.19
65 0.16
66 0.14
67 0.11
68 0.09
69 0.09
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.07
76 0.09
77 0.13
78 0.14
79 0.14
80 0.17
81 0.2
82 0.23
83 0.23
84 0.22
85 0.21
86 0.19
87 0.21
88 0.18
89 0.17
90 0.18
91 0.22
92 0.25
93 0.25
94 0.24
95 0.24
96 0.26
97 0.26
98 0.22
99 0.19
100 0.18
101 0.18
102 0.17
103 0.16
104 0.14
105 0.13
106 0.12
107 0.13
108 0.12
109 0.1
110 0.12
111 0.12
112 0.14
113 0.15
114 0.16
115 0.14
116 0.15
117 0.19
118 0.18
119 0.18
120 0.15
121 0.14
122 0.14
123 0.13
124 0.14
125 0.13
126 0.12
127 0.12
128 0.15
129 0.15
130 0.15
131 0.16
132 0.13
133 0.1
134 0.11
135 0.1
136 0.09
137 0.1
138 0.09
139 0.09
140 0.1
141 0.1
142 0.09
143 0.1
144 0.09
145 0.08
146 0.07
147 0.08
148 0.08
149 0.09
150 0.1
151 0.08
152 0.08
153 0.08
154 0.09
155 0.09
156 0.08
157 0.07
158 0.07
159 0.11
160 0.13
161 0.12
162 0.11
163 0.11
164 0.11
165 0.12
166 0.11
167 0.09
168 0.08
169 0.09
170 0.1
171 0.1
172 0.09
173 0.08
174 0.08
175 0.06
176 0.06
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.04
184 0.05
185 0.05
186 0.05
187 0.06
188 0.07
189 0.09
190 0.08
191 0.09
192 0.12
193 0.16
194 0.17
195 0.18
196 0.18
197 0.25
198 0.31
199 0.31
200 0.3
201 0.28
202 0.27
203 0.29
204 0.34
205 0.34
206 0.28
207 0.29
208 0.26
209 0.26
210 0.25
211 0.21
212 0.15
213 0.07
214 0.06
215 0.05
216 0.04
217 0.04
218 0.04
219 0.05
220 0.05
221 0.06
222 0.06
223 0.11
224 0.11
225 0.11
226 0.11
227 0.12
228 0.12
229 0.12
230 0.11
231 0.07
232 0.09
233 0.09
234 0.09
235 0.08
236 0.07
237 0.07
238 0.09
239 0.08
240 0.06
241 0.09
242 0.1
243 0.1
244 0.11
245 0.12
246 0.17
247 0.2
248 0.26
249 0.32
250 0.33
251 0.34
252 0.36
253 0.39
254 0.42
255 0.46
256 0.44
257 0.4
258 0.41
259 0.4
260 0.42
261 0.39
262 0.31
263 0.25
264 0.24
265 0.22
266 0.21
267 0.2
268 0.16
269 0.16
270 0.16
271 0.14
272 0.12
273 0.1
274 0.09
275 0.09
276 0.08
277 0.07
278 0.07
279 0.08
280 0.08
281 0.07
282 0.06
283 0.08
284 0.09
285 0.09
286 0.09
287 0.09
288 0.09
289 0.09
290 0.1
291 0.13
292 0.16
293 0.18
294 0.28
295 0.36
296 0.45
297 0.55
298 0.64
299 0.69
300 0.75
301 0.82
302 0.79
303 0.81
304 0.73
305 0.68
306 0.59
307 0.5
308 0.41
309 0.33
310 0.27
311 0.18
312 0.17
313 0.13
314 0.11
315 0.12
316 0.11
317 0.1
318 0.09
319 0.09
320 0.09
321 0.09
322 0.1
323 0.09
324 0.1
325 0.1
326 0.11
327 0.1
328 0.09
329 0.09
330 0.1
331 0.1
332 0.09
333 0.1
334 0.09
335 0.08
336 0.12
337 0.11
338 0.12
339 0.15
340 0.16
341 0.17
342 0.19
343 0.19
344 0.16
345 0.15
346 0.14
347 0.12
348 0.11
349 0.09
350 0.07
351 0.07
352 0.06
353 0.06
354 0.05
355 0.05
356 0.04
357 0.04
358 0.04
359 0.04
360 0.04
361 0.04
362 0.04
363 0.05
364 0.05
365 0.07
366 0.08
367 0.12
368 0.14
369 0.19
370 0.2
371 0.25
372 0.3
373 0.38
374 0.46
375 0.53
376 0.57
377 0.62