Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZPC6

Protein Details
Accession C7ZPC6    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
239-263AKLSSISVCRRQRKPKGTVRFLPCDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004821  Cyt_trans-like  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0009058  P:biosynthetic process  
KEGG nhe:NECHADRAFT_85672  -  
Pfam View protein in Pfam  
PF01467  CTP_transf_like  
Amino Acid Sequences MAFRPLANYAEAIHFQSKDTSALANRPFNNGSAAAAPILRPRGVNRILLFPGSFNPPHQGHLKLLQHVFNNAGDDLNIVAAIVIMTDDDRLKDKLCTEEKPLILSREQRVNLWRGTGIPVNWVWIYDKSESEWETFRTQLSAKVRKDGIDLKFILLGGPDVIGAGGMCNPEYWKCADCITSDISRAVDFRYPNTLRQIPGCSMWERLAFDRIRLEGQIRARLQGKPAAAIEEAISAAFAKLSSISVCRRQRKPKGTVRFLPCDISLRPSDPPSSTKIRQIVATVPKEELQAKLEGIALSPAILAEYINKSQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.24
4 0.24
5 0.21
6 0.21
7 0.21
8 0.2
9 0.27
10 0.33
11 0.37
12 0.37
13 0.41
14 0.41
15 0.38
16 0.38
17 0.31
18 0.26
19 0.2
20 0.19
21 0.15
22 0.14
23 0.14
24 0.15
25 0.17
26 0.16
27 0.16
28 0.18
29 0.26
30 0.28
31 0.34
32 0.31
33 0.34
34 0.35
35 0.35
36 0.33
37 0.25
38 0.25
39 0.24
40 0.23
41 0.19
42 0.24
43 0.23
44 0.26
45 0.28
46 0.29
47 0.26
48 0.34
49 0.37
50 0.37
51 0.38
52 0.39
53 0.37
54 0.36
55 0.35
56 0.27
57 0.25
58 0.19
59 0.16
60 0.12
61 0.11
62 0.1
63 0.08
64 0.06
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.02
71 0.02
72 0.03
73 0.04
74 0.04
75 0.05
76 0.08
77 0.09
78 0.11
79 0.13
80 0.14
81 0.22
82 0.25
83 0.27
84 0.31
85 0.36
86 0.35
87 0.37
88 0.38
89 0.32
90 0.31
91 0.33
92 0.31
93 0.32
94 0.33
95 0.31
96 0.33
97 0.34
98 0.31
99 0.28
100 0.24
101 0.17
102 0.2
103 0.2
104 0.16
105 0.15
106 0.14
107 0.15
108 0.14
109 0.14
110 0.13
111 0.12
112 0.15
113 0.14
114 0.14
115 0.13
116 0.16
117 0.16
118 0.16
119 0.16
120 0.16
121 0.16
122 0.16
123 0.15
124 0.14
125 0.13
126 0.17
127 0.24
128 0.3
129 0.29
130 0.33
131 0.34
132 0.33
133 0.35
134 0.36
135 0.3
136 0.27
137 0.27
138 0.22
139 0.22
140 0.22
141 0.19
142 0.12
143 0.1
144 0.05
145 0.04
146 0.03
147 0.03
148 0.03
149 0.03
150 0.02
151 0.02
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.05
158 0.07
159 0.08
160 0.08
161 0.09
162 0.1
163 0.11
164 0.11
165 0.13
166 0.15
167 0.14
168 0.14
169 0.14
170 0.14
171 0.13
172 0.13
173 0.12
174 0.12
175 0.12
176 0.12
177 0.21
178 0.22
179 0.24
180 0.3
181 0.31
182 0.28
183 0.31
184 0.33
185 0.25
186 0.26
187 0.26
188 0.21
189 0.2
190 0.21
191 0.21
192 0.19
193 0.19
194 0.23
195 0.21
196 0.21
197 0.22
198 0.21
199 0.2
200 0.19
201 0.19
202 0.17
203 0.21
204 0.27
205 0.25
206 0.27
207 0.29
208 0.3
209 0.3
210 0.3
211 0.27
212 0.22
213 0.22
214 0.21
215 0.18
216 0.17
217 0.15
218 0.11
219 0.11
220 0.08
221 0.08
222 0.05
223 0.05
224 0.05
225 0.04
226 0.04
227 0.04
228 0.05
229 0.07
230 0.1
231 0.14
232 0.24
233 0.33
234 0.42
235 0.51
236 0.61
237 0.7
238 0.76
239 0.82
240 0.83
241 0.85
242 0.86
243 0.86
244 0.83
245 0.8
246 0.72
247 0.65
248 0.56
249 0.5
250 0.41
251 0.37
252 0.31
253 0.27
254 0.28
255 0.27
256 0.29
257 0.28
258 0.29
259 0.3
260 0.36
261 0.37
262 0.41
263 0.43
264 0.42
265 0.41
266 0.41
267 0.43
268 0.44
269 0.46
270 0.4
271 0.37
272 0.36
273 0.38
274 0.37
275 0.31
276 0.24
277 0.22
278 0.2
279 0.19
280 0.2
281 0.17
282 0.16
283 0.15
284 0.12
285 0.1
286 0.09
287 0.08
288 0.06
289 0.06
290 0.06
291 0.09
292 0.14