Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MUL8

Protein Details
Accession A0A1B7MUL8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-100VSEHNIRRRRWLPRLKKRKVPLLPYFHydrophilic
NLS Segment(s)
PositionSequence
81-93RRRRWLPRLKKRK
Subcellular Location(s) plas 22, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013657  SCL35B1-4/HUT1  
Gene Ontology GO:0016020  C:membrane  
GO:0008643  P:carbohydrate transport  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF08449  UAA  
Amino Acid Sequences MLSPSDWITTLSLVFGGCCSNAITLEHITSRYPNSGILITFFQFLIVSLYGLPNQFTFNDPQESKHAADGVNGPVSEHNIRRRRWLPRLKKRKVPLLPYFVQVALFLVLSTLNNAAFAYDIPMAVHIVFRSGGMIINMILGFIFTKKRYTMRQVASVLIVTAGVILTTLSASKPQSHTTAAEAPDISLYAVGIAILSLALVLSGFLGLIQDWVFAQYIMPAQAQGSDPTGQWQENMFYLHSLALPMFYFSRETISMELASMSSSPPVFLSLPGSGPLAPYEAGVTLPSALVYLLLNTCTQLLCVVGVNRLTGRVSSLTVTLILTVRKAVSLLLSAAVYGGQGNMKMWAGAALVFIGTINYSTGSKPKQEREKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.08
6 0.09
7 0.09
8 0.1
9 0.11
10 0.14
11 0.14
12 0.17
13 0.18
14 0.18
15 0.18
16 0.2
17 0.22
18 0.22
19 0.21
20 0.2
21 0.21
22 0.22
23 0.21
24 0.2
25 0.2
26 0.18
27 0.18
28 0.17
29 0.14
30 0.12
31 0.12
32 0.13
33 0.1
34 0.1
35 0.09
36 0.1
37 0.12
38 0.13
39 0.13
40 0.1
41 0.12
42 0.12
43 0.14
44 0.17
45 0.19
46 0.27
47 0.27
48 0.29
49 0.33
50 0.36
51 0.35
52 0.32
53 0.31
54 0.23
55 0.25
56 0.26
57 0.23
58 0.22
59 0.2
60 0.19
61 0.17
62 0.21
63 0.23
64 0.25
65 0.31
66 0.36
67 0.38
68 0.46
69 0.53
70 0.59
71 0.65
72 0.71
73 0.73
74 0.77
75 0.87
76 0.86
77 0.88
78 0.86
79 0.86
80 0.83
81 0.81
82 0.79
83 0.76
84 0.69
85 0.62
86 0.56
87 0.46
88 0.37
89 0.28
90 0.19
91 0.12
92 0.09
93 0.07
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.05
100 0.05
101 0.06
102 0.05
103 0.05
104 0.05
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.08
111 0.08
112 0.08
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.05
123 0.06
124 0.06
125 0.05
126 0.05
127 0.04
128 0.04
129 0.05
130 0.08
131 0.07
132 0.1
133 0.12
134 0.16
135 0.2
136 0.28
137 0.36
138 0.37
139 0.43
140 0.42
141 0.41
142 0.38
143 0.34
144 0.26
145 0.17
146 0.13
147 0.06
148 0.05
149 0.03
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.03
156 0.03
157 0.05
158 0.06
159 0.09
160 0.11
161 0.13
162 0.15
163 0.16
164 0.17
165 0.18
166 0.22
167 0.2
168 0.2
169 0.18
170 0.16
171 0.14
172 0.13
173 0.1
174 0.05
175 0.04
176 0.03
177 0.03
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.01
186 0.01
187 0.01
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.03
196 0.03
197 0.03
198 0.03
199 0.04
200 0.05
201 0.04
202 0.04
203 0.05
204 0.06
205 0.07
206 0.07
207 0.06
208 0.06
209 0.08
210 0.08
211 0.08
212 0.1
213 0.1
214 0.1
215 0.12
216 0.14
217 0.12
218 0.12
219 0.12
220 0.11
221 0.12
222 0.13
223 0.11
224 0.09
225 0.1
226 0.1
227 0.09
228 0.08
229 0.07
230 0.06
231 0.06
232 0.07
233 0.07
234 0.07
235 0.08
236 0.08
237 0.11
238 0.11
239 0.12
240 0.12
241 0.13
242 0.13
243 0.12
244 0.12
245 0.09
246 0.08
247 0.07
248 0.06
249 0.06
250 0.06
251 0.06
252 0.06
253 0.08
254 0.08
255 0.09
256 0.12
257 0.11
258 0.12
259 0.13
260 0.13
261 0.11
262 0.11
263 0.11
264 0.09
265 0.08
266 0.08
267 0.08
268 0.07
269 0.07
270 0.07
271 0.07
272 0.06
273 0.06
274 0.05
275 0.05
276 0.04
277 0.05
278 0.05
279 0.06
280 0.06
281 0.07
282 0.07
283 0.07
284 0.08
285 0.08
286 0.08
287 0.07
288 0.07
289 0.06
290 0.09
291 0.09
292 0.11
293 0.12
294 0.13
295 0.13
296 0.14
297 0.14
298 0.12
299 0.14
300 0.12
301 0.13
302 0.13
303 0.14
304 0.13
305 0.13
306 0.13
307 0.12
308 0.12
309 0.11
310 0.11
311 0.12
312 0.11
313 0.11
314 0.11
315 0.1
316 0.09
317 0.1
318 0.1
319 0.1
320 0.1
321 0.09
322 0.09
323 0.09
324 0.07
325 0.06
326 0.06
327 0.06
328 0.07
329 0.07
330 0.09
331 0.09
332 0.09
333 0.09
334 0.09
335 0.09
336 0.09
337 0.08
338 0.07
339 0.06
340 0.06
341 0.06
342 0.05
343 0.05
344 0.05
345 0.05
346 0.07
347 0.08
348 0.1
349 0.17
350 0.21
351 0.29
352 0.37
353 0.47
354 0.56