Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7N8Z4

Protein Details
Accession A0A1B7N8Z4    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-21TVHIAKVKVRPRKNLPPNVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MTVHIAKVKVRPRKNLPPNVCAVELSNMLGCWAATGDVLASNQCQAAAESLFQCMRTAPVRGKQPRSSINYHLARLGRNSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.79
4 0.74
5 0.73
6 0.67
7 0.58
8 0.47
9 0.38
10 0.3
11 0.24
12 0.2
13 0.14
14 0.1
15 0.1
16 0.09
17 0.07
18 0.05
19 0.04
20 0.04
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.06
35 0.07
36 0.07
37 0.09
38 0.09
39 0.09
40 0.09
41 0.08
42 0.11
43 0.12
44 0.15
45 0.18
46 0.24
47 0.34
48 0.42
49 0.49
50 0.53
51 0.58
52 0.63
53 0.65
54 0.64
55 0.6
56 0.62
57 0.59
58 0.55
59 0.53
60 0.47
61 0.43