Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7N1J0

Protein Details
Accession A0A1B7N1J0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-121DGPGGKAEKKRLRKENQQRIKDQNFMKHydrophilic
NLS Segment(s)
PositionSequence
100-108KAEKKRLRK
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSVLTVLSRSCVRRAFSPFLVRGYAAKTPSTEQKSGVGAKDTSAVEEKTLSSCPPGTVLEGLNYLKGQPAVIALPDEEYPPWLWDLLKPKVYEDDGPGGKAEKKRLRKENQQRIKDQNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.46
4 0.52
5 0.49
6 0.47
7 0.45
8 0.39
9 0.33
10 0.31
11 0.28
12 0.22
13 0.21
14 0.2
15 0.22
16 0.3
17 0.34
18 0.31
19 0.28
20 0.3
21 0.32
22 0.33
23 0.31
24 0.26
25 0.2
26 0.19
27 0.22
28 0.19
29 0.17
30 0.17
31 0.15
32 0.13
33 0.13
34 0.13
35 0.11
36 0.11
37 0.1
38 0.09
39 0.1
40 0.09
41 0.1
42 0.1
43 0.09
44 0.1
45 0.1
46 0.09
47 0.1
48 0.1
49 0.09
50 0.09
51 0.08
52 0.07
53 0.07
54 0.06
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.05
61 0.06
62 0.07
63 0.07
64 0.06
65 0.08
66 0.08
67 0.08
68 0.09
69 0.08
70 0.08
71 0.12
72 0.19
73 0.23
74 0.27
75 0.26
76 0.27
77 0.31
78 0.33
79 0.3
80 0.27
81 0.29
82 0.26
83 0.26
84 0.25
85 0.24
86 0.26
87 0.29
88 0.35
89 0.37
90 0.46
91 0.55
92 0.65
93 0.72
94 0.79
95 0.86
96 0.88
97 0.89
98 0.88
99 0.86
100 0.86
101 0.83
102 0.8
103 0.74