Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MFJ3

Protein Details
Accession A0A1B7MFJ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-106LSDKDEKRVKSRNRGRRSIRINAGHydrophilic
NLS Segment(s)
PositionSequence
90-99RVKSRNRGRR
Subcellular Location(s) plas 19, mito 4, pero 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASGQNEVEKYVLHFHRISFILRENVFLVLLAAIILKFKLTDRLLMVSPSIISVISAIIYSGTRGASCFPPSSRCTEGEMGVLSDKDEKRVKSRNRGRRSIRINAGTGNVYFLPRHLWGSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.29
4 0.3
5 0.3
6 0.25
7 0.28
8 0.3
9 0.29
10 0.3
11 0.25
12 0.24
13 0.22
14 0.18
15 0.14
16 0.07
17 0.07
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.03
24 0.04
25 0.04
26 0.11
27 0.12
28 0.14
29 0.15
30 0.18
31 0.18
32 0.18
33 0.18
34 0.12
35 0.11
36 0.09
37 0.08
38 0.05
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.06
53 0.08
54 0.1
55 0.11
56 0.12
57 0.16
58 0.18
59 0.23
60 0.24
61 0.24
62 0.26
63 0.26
64 0.26
65 0.23
66 0.22
67 0.17
68 0.15
69 0.13
70 0.1
71 0.14
72 0.14
73 0.18
74 0.22
75 0.23
76 0.3
77 0.4
78 0.48
79 0.53
80 0.63
81 0.69
82 0.74
83 0.82
84 0.83
85 0.83
86 0.83
87 0.81
88 0.8
89 0.74
90 0.67
91 0.59
92 0.53
93 0.45
94 0.37
95 0.31
96 0.23
97 0.19
98 0.17
99 0.15
100 0.17
101 0.17