Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7YTF7

Protein Details
Accession C7YTF7    Localization Confidence High Confidence Score 26.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-43AEKGTDFKKLKLKRKQKEAEKRNKAARRGAABasic
350-370GTVNHKRAKKNEKYGFGGKKRBasic
393-414AGGSKVSKARPGKARRKAMGARHydrophilic
NLS Segment(s)
PositionSequence
19-41FKKLKLKRKQKEAEKRNKAARRG
105-111RKSKKSA
262-307KKAAAEARKLRDLKKFGKQVQVAKLQERQKAKRETLEKIKTLKRKR
354-374HKRAKKNEKYGFGGKKRHAKS
388-414AKKMKAGGSKVSKARPGKARRKAMGAR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008610  Ebp2  
Gene Ontology GO:0034399  C:nuclear periphery  
GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0042802  F:identical protein binding  
GO:0000280  P:nuclear division  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0006364  P:rRNA processing  
KEGG nhe:NECHADRAFT_48982  -  
Pfam View protein in Pfam  
PF05890  Ebp2  
Amino Acid Sequences MVTKGKLKMALAAEKGTDFKKLKLKRKQKEAEKRNKAARRGAAEESDEEEEIENEVAEGDDDEDEEDEEKSQLERHTDQYQYNLEGIDDSDDSDSSIELEEKIPRKSKKSASPAAKKVADEEDDEEEEDDEDIPMSDLEDLDDADKEDLIPHQRLTINNTTALLAALNRIAIPSDKSVPFATHQSVLAGSETSASIPDVQDDLQRELAFYSQSLDAARQARKLLRAEGVPFSRPKDYFAEMVKEDAHMEKVKAKLVEEASNKKAAAEARKLRDLKKFGKQVQVAKLQERQKAKRETLEKIKTLKRKRQESGGADLGTNEADLFDVGVESEMKKHNQRSGAGRGQMGAGSGTVNHKRAKKNEKYGFGGKKRHAKSGDAMSSSDLSGFNAKKMKAGGSKVSKARPGKARRKAMGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.29
4 0.32
5 0.26
6 0.3
7 0.38
8 0.46
9 0.55
10 0.64
11 0.74
12 0.76
13 0.85
14 0.89
15 0.91
16 0.93
17 0.93
18 0.94
19 0.93
20 0.92
21 0.92
22 0.89
23 0.85
24 0.82
25 0.79
26 0.75
27 0.69
28 0.65
29 0.58
30 0.52
31 0.47
32 0.42
33 0.36
34 0.29
35 0.24
36 0.2
37 0.16
38 0.15
39 0.13
40 0.09
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.12
59 0.14
60 0.18
61 0.21
62 0.25
63 0.3
64 0.34
65 0.34
66 0.36
67 0.37
68 0.33
69 0.31
70 0.26
71 0.2
72 0.17
73 0.16
74 0.13
75 0.1
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.06
83 0.07
84 0.07
85 0.07
86 0.09
87 0.15
88 0.18
89 0.23
90 0.31
91 0.34
92 0.39
93 0.46
94 0.53
95 0.57
96 0.63
97 0.68
98 0.71
99 0.76
100 0.77
101 0.77
102 0.72
103 0.62
104 0.55
105 0.5
106 0.41
107 0.33
108 0.29
109 0.24
110 0.22
111 0.22
112 0.2
113 0.16
114 0.14
115 0.13
116 0.1
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.08
136 0.12
137 0.13
138 0.12
139 0.16
140 0.19
141 0.2
142 0.25
143 0.3
144 0.27
145 0.26
146 0.27
147 0.23
148 0.21
149 0.2
150 0.14
151 0.07
152 0.06
153 0.06
154 0.05
155 0.05
156 0.04
157 0.05
158 0.05
159 0.07
160 0.08
161 0.12
162 0.13
163 0.15
164 0.15
165 0.16
166 0.17
167 0.18
168 0.18
169 0.15
170 0.15
171 0.13
172 0.13
173 0.12
174 0.11
175 0.08
176 0.06
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.06
185 0.06
186 0.06
187 0.08
188 0.1
189 0.11
190 0.12
191 0.12
192 0.11
193 0.11
194 0.11
195 0.09
196 0.07
197 0.08
198 0.06
199 0.07
200 0.07
201 0.07
202 0.1
203 0.15
204 0.16
205 0.15
206 0.17
207 0.19
208 0.23
209 0.24
210 0.23
211 0.21
212 0.21
213 0.22
214 0.25
215 0.25
216 0.23
217 0.22
218 0.22
219 0.24
220 0.23
221 0.23
222 0.22
223 0.23
224 0.24
225 0.25
226 0.26
227 0.23
228 0.24
229 0.21
230 0.17
231 0.16
232 0.13
233 0.14
234 0.11
235 0.11
236 0.14
237 0.16
238 0.19
239 0.18
240 0.18
241 0.21
242 0.22
243 0.28
244 0.29
245 0.33
246 0.33
247 0.35
248 0.34
249 0.29
250 0.29
251 0.26
252 0.27
253 0.3
254 0.36
255 0.37
256 0.45
257 0.48
258 0.49
259 0.54
260 0.54
261 0.52
262 0.53
263 0.58
264 0.55
265 0.62
266 0.63
267 0.62
268 0.62
269 0.64
270 0.58
271 0.53
272 0.55
273 0.52
274 0.53
275 0.55
276 0.53
277 0.54
278 0.59
279 0.59
280 0.6
281 0.59
282 0.61
283 0.63
284 0.65
285 0.61
286 0.61
287 0.65
288 0.67
289 0.71
290 0.72
291 0.71
292 0.73
293 0.72
294 0.74
295 0.75
296 0.7
297 0.68
298 0.65
299 0.56
300 0.46
301 0.42
302 0.33
303 0.24
304 0.19
305 0.11
306 0.05
307 0.04
308 0.04
309 0.04
310 0.03
311 0.03
312 0.04
313 0.04
314 0.05
315 0.06
316 0.09
317 0.13
318 0.17
319 0.24
320 0.28
321 0.33
322 0.38
323 0.43
324 0.46
325 0.52
326 0.56
327 0.53
328 0.49
329 0.44
330 0.39
331 0.34
332 0.27
333 0.18
334 0.11
335 0.07
336 0.08
337 0.14
338 0.18
339 0.21
340 0.26
341 0.33
342 0.4
343 0.5
344 0.6
345 0.64
346 0.71
347 0.76
348 0.78
349 0.79
350 0.81
351 0.82
352 0.8
353 0.79
354 0.75
355 0.76
356 0.72
357 0.74
358 0.67
359 0.61
360 0.59
361 0.61
362 0.6
363 0.52
364 0.49
365 0.43
366 0.41
367 0.36
368 0.31
369 0.2
370 0.14
371 0.2
372 0.2
373 0.22
374 0.27
375 0.27
376 0.29
377 0.31
378 0.37
379 0.37
380 0.41
381 0.47
382 0.49
383 0.58
384 0.61
385 0.65
386 0.67
387 0.65
388 0.68
389 0.69
390 0.71
391 0.73
392 0.77
393 0.81
394 0.78