Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MF42

Protein Details
Accession A0A1B7MF42    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
209-232GVMPNRRTRFVRQKSDGKKWKEVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024624  Pyridox_Oxase_Alr4036_FMN-bd  
IPR012349  Split_barrel_FMN-bd  
Gene Ontology GO:0010181  F:FMN binding  
Pfam View protein in Pfam  
PF12766  Pyridox_oxase_2  
Amino Acid Sequences MMGAHTARWHTALKDALQKEEGMKNIFQFATTDVNTTPYVRSLVLRDHIIHPSLPSLPLLLTTTDIRTSKVTQIKSSSNRRVEANFWIKATNEQFRISGRAAIYPSPKLSEQKGIEGVGEVYDAFKSQGWNWEDERRKQFDNIGAHMRASWCRPVPGSPMNSYSDAEKWPVKVPKPEEEGYDADEYEEALGNFGLLLIDPIEVDFVELGVMPNRRTRFVRQKSDGKKWKEVILVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.37
4 0.36
5 0.36
6 0.35
7 0.35
8 0.35
9 0.29
10 0.28
11 0.26
12 0.29
13 0.28
14 0.24
15 0.2
16 0.19
17 0.21
18 0.2
19 0.21
20 0.16
21 0.2
22 0.2
23 0.21
24 0.19
25 0.14
26 0.16
27 0.15
28 0.16
29 0.15
30 0.2
31 0.22
32 0.23
33 0.24
34 0.26
35 0.28
36 0.27
37 0.25
38 0.21
39 0.2
40 0.18
41 0.16
42 0.13
43 0.11
44 0.1
45 0.11
46 0.11
47 0.09
48 0.1
49 0.11
50 0.12
51 0.15
52 0.16
53 0.16
54 0.17
55 0.19
56 0.25
57 0.3
58 0.3
59 0.3
60 0.34
61 0.4
62 0.46
63 0.53
64 0.55
65 0.53
66 0.53
67 0.52
68 0.5
69 0.45
70 0.46
71 0.42
72 0.35
73 0.31
74 0.29
75 0.28
76 0.3
77 0.31
78 0.27
79 0.23
80 0.22
81 0.22
82 0.22
83 0.25
84 0.21
85 0.21
86 0.16
87 0.16
88 0.16
89 0.18
90 0.19
91 0.17
92 0.17
93 0.16
94 0.17
95 0.17
96 0.17
97 0.22
98 0.21
99 0.22
100 0.23
101 0.21
102 0.19
103 0.18
104 0.16
105 0.08
106 0.08
107 0.05
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.06
114 0.06
115 0.14
116 0.15
117 0.18
118 0.2
119 0.28
120 0.32
121 0.38
122 0.44
123 0.4
124 0.41
125 0.39
126 0.4
127 0.38
128 0.37
129 0.34
130 0.33
131 0.3
132 0.28
133 0.28
134 0.26
135 0.21
136 0.19
137 0.2
138 0.16
139 0.17
140 0.18
141 0.19
142 0.23
143 0.28
144 0.29
145 0.27
146 0.29
147 0.31
148 0.31
149 0.3
150 0.26
151 0.22
152 0.19
153 0.2
154 0.18
155 0.18
156 0.23
157 0.29
158 0.31
159 0.36
160 0.4
161 0.45
162 0.49
163 0.49
164 0.44
165 0.42
166 0.4
167 0.36
168 0.33
169 0.25
170 0.19
171 0.17
172 0.15
173 0.11
174 0.11
175 0.07
176 0.07
177 0.06
178 0.06
179 0.06
180 0.06
181 0.05
182 0.03
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.05
189 0.05
190 0.05
191 0.05
192 0.04
193 0.04
194 0.05
195 0.06
196 0.1
197 0.12
198 0.13
199 0.2
200 0.22
201 0.27
202 0.31
203 0.4
204 0.47
205 0.55
206 0.65
207 0.67
208 0.75
209 0.8
210 0.88
211 0.87
212 0.84
213 0.83
214 0.76
215 0.74