Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7N2E0

Protein Details
Accession A0A1B7N2E0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
105-130DMVEGTKQKRRSRRHGLWKGFRNLFFHydrophilic
NLS Segment(s)
PositionSequence
113-118KRRSRR
Subcellular Location(s) cyto_nucl 8, nucl 7.5, cyto 7.5, pero 6, mito 4
Family & Domain DBs
Amino Acid Sequences MSGAAAAHDVHNTDTEQRQGKHLKEDKGAYVQSHLARARIEGIEKWRAAVDAALQAAEEDSEQPNKNQPRNEEEMWGALEELRQKEKTETAGDTKVDVLEQKPTDMVEGTKQKRRSRRHGLWKGFRNLFFTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.28
4 0.28
5 0.35
6 0.4
7 0.42
8 0.48
9 0.53
10 0.53
11 0.52
12 0.55
13 0.51
14 0.5
15 0.48
16 0.38
17 0.34
18 0.33
19 0.27
20 0.3
21 0.27
22 0.23
23 0.21
24 0.21
25 0.21
26 0.18
27 0.18
28 0.15
29 0.19
30 0.23
31 0.23
32 0.23
33 0.2
34 0.19
35 0.18
36 0.15
37 0.12
38 0.08
39 0.08
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.04
47 0.05
48 0.08
49 0.09
50 0.1
51 0.17
52 0.22
53 0.26
54 0.27
55 0.29
56 0.32
57 0.38
58 0.39
59 0.34
60 0.29
61 0.26
62 0.24
63 0.21
64 0.15
65 0.09
66 0.09
67 0.1
68 0.11
69 0.14
70 0.14
71 0.15
72 0.17
73 0.19
74 0.21
75 0.21
76 0.22
77 0.23
78 0.26
79 0.25
80 0.24
81 0.22
82 0.19
83 0.17
84 0.15
85 0.12
86 0.15
87 0.15
88 0.15
89 0.15
90 0.15
91 0.16
92 0.16
93 0.16
94 0.17
95 0.27
96 0.32
97 0.39
98 0.47
99 0.53
100 0.62
101 0.71
102 0.73
103 0.74
104 0.8
105 0.84
106 0.87
107 0.9
108 0.91
109 0.91
110 0.9
111 0.86
112 0.77