Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MVZ3

Protein Details
Accession A0A1B7MVZ3    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-27RMITRSQTLKKRLVKPLPRGSQLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 10.666, nucl 5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR011600  Pept_C14_caspase  
Gene Ontology GO:0004197  F:cysteine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00656  Peptidase_C14  
Amino Acid Sequences MEFRMITRSQTLKKRLVKPLPRGSQLFALFDSCHSDTILDLDHHKCNKLHSGGTGTGTRRKSLTDFFFPDRVSRPKTLRNPSLTLNSVLIRPHSPTSWLPHMFVDSPPSALRRVLSPDSWINKCTGNCPKPEEQQEAHVVSLSACRDNENAYDDNETGGTMTKFFIECVHRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.78
4 0.8
5 0.81
6 0.85
7 0.84
8 0.8
9 0.73
10 0.66
11 0.63
12 0.55
13 0.46
14 0.36
15 0.3
16 0.24
17 0.22
18 0.25
19 0.18
20 0.17
21 0.16
22 0.15
23 0.13
24 0.14
25 0.16
26 0.11
27 0.13
28 0.16
29 0.21
30 0.23
31 0.26
32 0.25
33 0.26
34 0.32
35 0.32
36 0.3
37 0.26
38 0.3
39 0.28
40 0.3
41 0.31
42 0.26
43 0.3
44 0.29
45 0.28
46 0.24
47 0.24
48 0.24
49 0.26
50 0.29
51 0.29
52 0.32
53 0.35
54 0.37
55 0.36
56 0.35
57 0.33
58 0.33
59 0.3
60 0.3
61 0.31
62 0.37
63 0.46
64 0.52
65 0.53
66 0.53
67 0.51
68 0.49
69 0.5
70 0.43
71 0.35
72 0.28
73 0.22
74 0.19
75 0.16
76 0.15
77 0.11
78 0.12
79 0.12
80 0.11
81 0.14
82 0.14
83 0.2
84 0.25
85 0.26
86 0.25
87 0.24
88 0.25
89 0.23
90 0.22
91 0.2
92 0.13
93 0.14
94 0.14
95 0.15
96 0.14
97 0.13
98 0.13
99 0.11
100 0.17
101 0.18
102 0.18
103 0.21
104 0.26
105 0.31
106 0.32
107 0.31
108 0.26
109 0.28
110 0.28
111 0.32
112 0.36
113 0.34
114 0.36
115 0.42
116 0.47
117 0.5
118 0.56
119 0.55
120 0.46
121 0.47
122 0.49
123 0.44
124 0.39
125 0.31
126 0.25
127 0.19
128 0.21
129 0.18
130 0.15
131 0.13
132 0.15
133 0.16
134 0.18
135 0.19
136 0.2
137 0.2
138 0.19
139 0.22
140 0.21
141 0.21
142 0.19
143 0.16
144 0.12
145 0.14
146 0.12
147 0.1
148 0.1
149 0.11
150 0.11
151 0.12
152 0.17