Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MQ48

Protein Details
Accession A0A1B7MQ48   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
92-112MPSTDKQRRWRLLRRGRYVKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 9, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001260  Coprogen_oxidase_aer  
IPR036406  Coprogen_oxidase_aer_sf  
IPR018375  Coprogen_oxidase_CS  
Gene Ontology GO:0004109  F:coproporphyrinogen oxidase activity  
GO:0006782  P:protoporphyrinogen IX biosynthetic process  
Pfam View protein in Pfam  
PF01218  Coprogen_oxidas  
PROSITE View protein in PROSITE  
PS01021  COPROGEN_OXIDASE  
Amino Acid Sequences TLQNVCNQHGTELYPAFKKWCDEYFYIAHRQEIRGIGGIFFDDLSTEKHTRLLDDIERPRSKEDMFDFIKALGNAFIPSYLPILERRMSMAMPSTDKQRRWRLLRRGRYVKFNFMHDRGTKFGLKAPSACIESMLIMSLPETARWEYMTDMGSDPESEGRLVAVLKKPIDWVWLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.27
5 0.28
6 0.28
7 0.29
8 0.31
9 0.31
10 0.35
11 0.38
12 0.4
13 0.44
14 0.41
15 0.4
16 0.37
17 0.36
18 0.35
19 0.31
20 0.28
21 0.25
22 0.24
23 0.2
24 0.17
25 0.16
26 0.13
27 0.1
28 0.09
29 0.05
30 0.06
31 0.08
32 0.13
33 0.14
34 0.14
35 0.18
36 0.18
37 0.19
38 0.2
39 0.22
40 0.2
41 0.28
42 0.34
43 0.39
44 0.4
45 0.41
46 0.41
47 0.39
48 0.35
49 0.32
50 0.28
51 0.27
52 0.27
53 0.27
54 0.26
55 0.24
56 0.26
57 0.2
58 0.18
59 0.11
60 0.09
61 0.08
62 0.08
63 0.07
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07
70 0.1
71 0.1
72 0.1
73 0.11
74 0.11
75 0.11
76 0.1
77 0.11
78 0.1
79 0.12
80 0.13
81 0.19
82 0.23
83 0.27
84 0.34
85 0.4
86 0.47
87 0.52
88 0.62
89 0.65
90 0.71
91 0.77
92 0.8
93 0.82
94 0.77
95 0.79
96 0.72
97 0.71
98 0.62
99 0.59
100 0.54
101 0.46
102 0.49
103 0.42
104 0.41
105 0.34
106 0.36
107 0.31
108 0.26
109 0.29
110 0.27
111 0.26
112 0.24
113 0.25
114 0.25
115 0.25
116 0.24
117 0.2
118 0.16
119 0.15
120 0.14
121 0.11
122 0.08
123 0.06
124 0.06
125 0.08
126 0.07
127 0.08
128 0.1
129 0.11
130 0.11
131 0.12
132 0.13
133 0.12
134 0.15
135 0.15
136 0.14
137 0.14
138 0.14
139 0.14
140 0.13
141 0.13
142 0.12
143 0.12
144 0.1
145 0.1
146 0.09
147 0.09
148 0.1
149 0.14
150 0.18
151 0.23
152 0.23
153 0.24
154 0.27
155 0.26
156 0.29