Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7MQR3

Protein Details
Accession A0A1B7MQR3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
32-51GEQWRRYRKKVPYRLVPWLYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, mito 5, E.R. 4, cyto_mito 4, cyto 3, plas 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences LAFLWVALTTVLCSGVGGRIQKEEVMLEKHFGEQWRRYRKKVPYRLVPWLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.1
4 0.11
5 0.11
6 0.12
7 0.12
8 0.13
9 0.13
10 0.11
11 0.11
12 0.13
13 0.12
14 0.12
15 0.12
16 0.13
17 0.14
18 0.17
19 0.2
20 0.25
21 0.34
22 0.44
23 0.49
24 0.53
25 0.6
26 0.68
27 0.74
28 0.77
29 0.77
30 0.77
31 0.8