Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MG80

Protein Details
Accession A0A1B7MG80    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KRFGPKRATKIRKFFNSSKEHydrophilic
54-73TPIRLQRRRHLRSLNRRRIDBasic
NLS Segment(s)
PositionSequence
29-72RREVKSSKKENAKPYTKAPKIQRLVTPIRLQRRRHLRSLNRRRI
93-96KKAK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences KRFGPKRATKIRKFFNSSKEDDVRKYVVRREVKSSKKENAKPYTKAPKIQRLVTPIRLQRRRHLRSLNRRRIDHQKEQKAEYDALVQKRVAEKKAKVAAIKASHHKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.77
4 0.72
5 0.7
6 0.66
7 0.6
8 0.54
9 0.52
10 0.47
11 0.44
12 0.43
13 0.41
14 0.43
15 0.47
16 0.47
17 0.51
18 0.57
19 0.6
20 0.65
21 0.66
22 0.65
23 0.67
24 0.71
25 0.72
26 0.72
27 0.71
28 0.65
29 0.68
30 0.7
31 0.63
32 0.64
33 0.61
34 0.61
35 0.57
36 0.58
37 0.52
38 0.48
39 0.49
40 0.46
41 0.46
42 0.41
43 0.47
44 0.5
45 0.5
46 0.52
47 0.58
48 0.58
49 0.6
50 0.65
51 0.65
52 0.7
53 0.79
54 0.81
55 0.78
56 0.76
57 0.74
58 0.75
59 0.73
60 0.72
61 0.72
62 0.7
63 0.67
64 0.68
65 0.67
66 0.6
67 0.52
68 0.42
69 0.39
70 0.35
71 0.33
72 0.33
73 0.28
74 0.27
75 0.34
76 0.37
77 0.35
78 0.38
79 0.38
80 0.45
81 0.53
82 0.54
83 0.49
84 0.48
85 0.51
86 0.5
87 0.54
88 0.54