Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MKD7

Protein Details
Accession A0A1B7MKD7   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
173-203HDSRSRSHSHSRSRSHLRSRSRHGSRSRSPABasic
NLS Segment(s)
PositionSequence
183-201SRSRSHLRSRSRHGSRSRS
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, mito 4
Family & Domain DBs
Amino Acid Sequences MSIVKQSSDTIKFPKGHTAYIFGSATAYRMQQVVVKVQKTSGSDLNECSFRGLNGPMAITSGGLGFVNQQAVVIPADNNKNRRLELIFSAYDNHMWATSDAEDIKGFQKNTQTSSVAPRVTSYIYRTEDGGDKDHDGTTFVVTLIADTEQVQPNGMHIPPSTSGTSSPTSSRHDSRSRSHSHSRSRSHLRSRSRHGSRSRSPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.44
4 0.41
5 0.41
6 0.36
7 0.38
8 0.37
9 0.26
10 0.25
11 0.21
12 0.2
13 0.16
14 0.15
15 0.1
16 0.1
17 0.11
18 0.13
19 0.15
20 0.22
21 0.27
22 0.28
23 0.27
24 0.28
25 0.31
26 0.3
27 0.32
28 0.29
29 0.27
30 0.27
31 0.3
32 0.31
33 0.29
34 0.27
35 0.25
36 0.2
37 0.15
38 0.16
39 0.14
40 0.14
41 0.13
42 0.14
43 0.11
44 0.12
45 0.12
46 0.09
47 0.08
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.05
57 0.05
58 0.06
59 0.07
60 0.06
61 0.06
62 0.09
63 0.15
64 0.19
65 0.22
66 0.24
67 0.26
68 0.26
69 0.28
70 0.26
71 0.22
72 0.22
73 0.24
74 0.21
75 0.2
76 0.21
77 0.19
78 0.17
79 0.15
80 0.12
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.09
92 0.11
93 0.11
94 0.12
95 0.18
96 0.18
97 0.21
98 0.23
99 0.23
100 0.21
101 0.26
102 0.29
103 0.24
104 0.23
105 0.2
106 0.19
107 0.19
108 0.19
109 0.16
110 0.18
111 0.19
112 0.2
113 0.2
114 0.2
115 0.22
116 0.22
117 0.23
118 0.18
119 0.17
120 0.18
121 0.18
122 0.16
123 0.14
124 0.13
125 0.11
126 0.1
127 0.09
128 0.08
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.07
135 0.1
136 0.13
137 0.13
138 0.14
139 0.13
140 0.14
141 0.17
142 0.15
143 0.13
144 0.11
145 0.14
146 0.14
147 0.18
148 0.18
149 0.16
150 0.16
151 0.19
152 0.21
153 0.2
154 0.21
155 0.21
156 0.26
157 0.31
158 0.35
159 0.39
160 0.44
161 0.48
162 0.53
163 0.59
164 0.6
165 0.62
166 0.68
167 0.69
168 0.72
169 0.76
170 0.76
171 0.76
172 0.79
173 0.81
174 0.81
175 0.81
176 0.81
177 0.81
178 0.84
179 0.85
180 0.83
181 0.83
182 0.82
183 0.83