Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MYZ6

Protein Details
Accession A0A1B7MYZ6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
65-84LFSTRHRSMNKRLNNHPRNPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 7cyto_nucl 7, nucl 6.5, cyto 6.5, mito 6
Family & Domain DBs
Amino Acid Sequences MLRLLLLPSCAPGYLLHVSIWSTMVNLHGSLDEACFIPGSDVLLRFVRHHSCCSCRRGIAEAVILFSTRHRSMNKRLNNHPRNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.14
4 0.14
5 0.14
6 0.14
7 0.15
8 0.1
9 0.07
10 0.07
11 0.08
12 0.08
13 0.08
14 0.07
15 0.07
16 0.08
17 0.08
18 0.08
19 0.07
20 0.06
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.06
27 0.06
28 0.06
29 0.08
30 0.09
31 0.1
32 0.11
33 0.14
34 0.18
35 0.19
36 0.23
37 0.25
38 0.3
39 0.36
40 0.4
41 0.4
42 0.36
43 0.36
44 0.36
45 0.35
46 0.31
47 0.3
48 0.25
49 0.23
50 0.21
51 0.2
52 0.16
53 0.15
54 0.18
55 0.15
56 0.2
57 0.23
58 0.3
59 0.4
60 0.5
61 0.58
62 0.6
63 0.69
64 0.76