Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NAM9

Protein Details
Accession A0A1B7NAM9   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MGKAERPKGKRSEEKKEKQKKKFIAKIEARRAMEBasic
NLS Segment(s)
PositionSequence
4-29AERPKGKRSEEKKEKQKKKFIAKIEA
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MGKAERPKGKRSEEKKEKQKKKFIAKIEARRAMEQESQGEESGQVDSNDVVDLLSNVDKPRVVVAEPGEVDSLAADISDKVLAGTMLSERTGTDEKDVPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.9
4 0.91
5 0.9
6 0.91
7 0.9
8 0.9
9 0.87
10 0.84
11 0.84
12 0.83
13 0.84
14 0.83
15 0.81
16 0.72
17 0.65
18 0.59
19 0.51
20 0.44
21 0.36
22 0.28
23 0.23
24 0.22
25 0.21
26 0.19
27 0.15
28 0.12
29 0.12
30 0.11
31 0.08
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.05
38 0.03
39 0.04
40 0.04
41 0.05
42 0.05
43 0.06
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.1
51 0.11
52 0.15
53 0.15
54 0.15
55 0.15
56 0.13
57 0.13
58 0.1
59 0.09
60 0.04
61 0.04
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.07
74 0.08
75 0.08
76 0.08
77 0.13
78 0.16
79 0.16
80 0.19