Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MTQ3

Protein Details
Accession A0A1B7MTQ3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
80-108DVEDKKKRGKGAPKKAKEKGDSRRAGRKRBasic
NLS Segment(s)
PositionSequence
84-108KKKRGKGAPKKAKEKGDSRRAGRKR
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAAAAIRPMRLAALTKTRCSIFQTAYNPTSARTGAKYLRARLRGPSMVKYYPAEANIAQIIRQWPELEMRNYAEEERLQDVEDKKKRGKGAPKKAKEKGDSRRAGRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.33
4 0.33
5 0.33
6 0.36
7 0.36
8 0.29
9 0.33
10 0.35
11 0.39
12 0.39
13 0.39
14 0.34
15 0.31
16 0.29
17 0.23
18 0.2
19 0.15
20 0.19
21 0.19
22 0.28
23 0.31
24 0.36
25 0.42
26 0.44
27 0.43
28 0.42
29 0.45
30 0.42
31 0.4
32 0.39
33 0.36
34 0.33
35 0.34
36 0.3
37 0.27
38 0.22
39 0.21
40 0.17
41 0.12
42 0.13
43 0.12
44 0.11
45 0.09
46 0.09
47 0.1
48 0.09
49 0.1
50 0.09
51 0.09
52 0.13
53 0.17
54 0.17
55 0.18
56 0.19
57 0.19
58 0.2
59 0.2
60 0.18
61 0.15
62 0.15
63 0.16
64 0.15
65 0.14
66 0.18
67 0.22
68 0.3
69 0.36
70 0.39
71 0.41
72 0.46
73 0.5
74 0.54
75 0.61
76 0.62
77 0.68
78 0.73
79 0.79
80 0.84
81 0.87
82 0.87
83 0.84
84 0.83
85 0.82
86 0.82
87 0.81
88 0.78