Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z6H7

Protein Details
Accession C7Z6H7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
78-97QVAKPAKKRAPRPAKSTGKTHydrophilic
NLS Segment(s)
PositionSequence
81-93KPAKKRAPRPAKS
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
KEGG nhe:NECHADRAFT_76106  -  
Amino Acid Sequences MSAVAANAAATSIATSKEVNEIKANMNKLRDQLVNKVTPVLVDPTTEKRANPAVRNPAARSSTAARGGISKANAFLQQVAKPAKKRAPRPAKSTGKTGASNGDEISWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.16
5 0.18
6 0.19
7 0.22
8 0.23
9 0.27
10 0.32
11 0.36
12 0.31
13 0.33
14 0.33
15 0.32
16 0.34
17 0.32
18 0.3
19 0.33
20 0.35
21 0.35
22 0.33
23 0.32
24 0.27
25 0.23
26 0.22
27 0.17
28 0.12
29 0.1
30 0.12
31 0.16
32 0.21
33 0.22
34 0.2
35 0.2
36 0.27
37 0.3
38 0.31
39 0.32
40 0.35
41 0.37
42 0.4
43 0.38
44 0.36
45 0.34
46 0.31
47 0.28
48 0.23
49 0.23
50 0.23
51 0.23
52 0.18
53 0.18
54 0.19
55 0.19
56 0.17
57 0.13
58 0.12
59 0.13
60 0.14
61 0.13
62 0.14
63 0.15
64 0.15
65 0.21
66 0.25
67 0.29
68 0.31
69 0.38
70 0.43
71 0.49
72 0.56
73 0.61
74 0.67
75 0.7
76 0.74
77 0.78
78 0.81
79 0.76
80 0.74
81 0.69
82 0.64
83 0.58
84 0.52
85 0.49
86 0.41
87 0.39
88 0.33