Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MZ68

Protein Details
Accession A0A1B7MZ68    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-47KVKSQTPKVDKQEKKKTPKGRAKKRILYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
12-38GKVKSQTPKVDKQEKKKTPKGRAKKRI
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVDKQEKKKTPKGRAKKRILYNRRFVNVTTLPGGKRRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.45
4 0.49
5 0.52
6 0.61
7 0.64
8 0.7
9 0.7
10 0.73
11 0.77
12 0.77
13 0.8
14 0.8
15 0.8
16 0.8
17 0.84
18 0.85
19 0.85
20 0.86
21 0.87
22 0.87
23 0.88
24 0.89
25 0.89
26 0.86
27 0.84
28 0.81
29 0.75
30 0.68
31 0.58
32 0.56
33 0.48
34 0.43
35 0.38
36 0.33
37 0.31