Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7NDK1

Protein Details
Accession A0A1B7NDK1    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKQKQKKPDAKKPSSSEQQPRNVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, mito 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007823  RRP8  
IPR042036  RRP8_N  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF05148  Methyltransf_8  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MKQKQKKPDAKKPSSSEQQPRNVSPAVDGVSGLTSLQKGMKESLDGARFRWINELLYKSDSSEAVRMMKEDPAVFNDYHSGFRHQVQSWPSNPVSHYISQLSSYPQNTVIADLGCGDAALARGLSSKKLKVLSFDLVSDGAYIVAADICSSVPLPGSEPSSSQKSEGEAQVVDVVVCALSLMGTNWPQCIREAWRILKPGGELKIAEVASRFSDVDEFVSLISSTGFKMKTKDDHNSHFTLFEFKKVPRTTKTNKEWSEVMSKGDILKPCEYKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.81
5 0.8
6 0.77
7 0.72
8 0.67
9 0.59
10 0.5
11 0.41
12 0.36
13 0.29
14 0.23
15 0.2
16 0.16
17 0.15
18 0.14
19 0.12
20 0.09
21 0.07
22 0.08
23 0.11
24 0.11
25 0.12
26 0.15
27 0.16
28 0.16
29 0.19
30 0.25
31 0.28
32 0.27
33 0.27
34 0.32
35 0.32
36 0.31
37 0.33
38 0.28
39 0.25
40 0.29
41 0.31
42 0.26
43 0.29
44 0.28
45 0.24
46 0.24
47 0.22
48 0.19
49 0.18
50 0.17
51 0.17
52 0.17
53 0.17
54 0.17
55 0.18
56 0.18
57 0.16
58 0.16
59 0.16
60 0.19
61 0.18
62 0.17
63 0.18
64 0.18
65 0.2
66 0.2
67 0.21
68 0.2
69 0.23
70 0.28
71 0.25
72 0.29
73 0.31
74 0.35
75 0.32
76 0.36
77 0.34
78 0.3
79 0.3
80 0.28
81 0.27
82 0.23
83 0.23
84 0.19
85 0.19
86 0.18
87 0.19
88 0.18
89 0.17
90 0.17
91 0.16
92 0.15
93 0.16
94 0.15
95 0.15
96 0.13
97 0.1
98 0.09
99 0.08
100 0.07
101 0.06
102 0.06
103 0.04
104 0.04
105 0.04
106 0.04
107 0.03
108 0.03
109 0.05
110 0.06
111 0.09
112 0.11
113 0.12
114 0.15
115 0.19
116 0.19
117 0.2
118 0.23
119 0.23
120 0.22
121 0.21
122 0.19
123 0.16
124 0.15
125 0.12
126 0.09
127 0.05
128 0.04
129 0.04
130 0.03
131 0.03
132 0.03
133 0.02
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.06
142 0.07
143 0.09
144 0.09
145 0.11
146 0.14
147 0.17
148 0.18
149 0.17
150 0.16
151 0.16
152 0.19
153 0.18
154 0.17
155 0.13
156 0.13
157 0.13
158 0.12
159 0.1
160 0.07
161 0.06
162 0.04
163 0.04
164 0.03
165 0.02
166 0.02
167 0.02
168 0.03
169 0.05
170 0.07
171 0.08
172 0.09
173 0.1
174 0.11
175 0.11
176 0.14
177 0.18
178 0.24
179 0.3
180 0.33
181 0.37
182 0.39
183 0.39
184 0.38
185 0.34
186 0.32
187 0.28
188 0.25
189 0.21
190 0.18
191 0.24
192 0.22
193 0.2
194 0.16
195 0.14
196 0.14
197 0.15
198 0.14
199 0.09
200 0.1
201 0.1
202 0.11
203 0.11
204 0.1
205 0.08
206 0.09
207 0.09
208 0.08
209 0.08
210 0.07
211 0.07
212 0.11
213 0.12
214 0.13
215 0.16
216 0.21
217 0.28
218 0.34
219 0.44
220 0.47
221 0.53
222 0.57
223 0.58
224 0.54
225 0.47
226 0.42
227 0.41
228 0.34
229 0.32
230 0.3
231 0.28
232 0.37
233 0.41
234 0.47
235 0.45
236 0.54
237 0.58
238 0.64
239 0.72
240 0.73
241 0.71
242 0.7
243 0.65
244 0.6
245 0.59
246 0.5
247 0.43
248 0.34
249 0.32
250 0.3
251 0.33
252 0.33
253 0.29
254 0.35
255 0.4