Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7N4C1

Protein Details
Accession A0A1B7N4C1   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
23-51QRQISNRYSRPPKDKHPRKKHDEEQQHVYBasic
NLS Segment(s)
PositionSequence
33-42PPKDKHPRKK
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MSVRSGAMMSKVGNPQVYEASEQRQISNRYSRPPKDKHPRKKHDEEQQHVYEDIESEDERGIGNKLAAMHAHSRQLPDPPRADPKVDPLGPATAHGNEPSKGAKVDAELKEEEEELLKRKGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.24
5 0.23
6 0.21
7 0.23
8 0.27
9 0.27
10 0.27
11 0.31
12 0.33
13 0.34
14 0.42
15 0.41
16 0.45
17 0.54
18 0.59
19 0.62
20 0.65
21 0.7
22 0.72
23 0.8
24 0.82
25 0.84
26 0.87
27 0.87
28 0.91
29 0.88
30 0.87
31 0.87
32 0.81
33 0.78
34 0.7
35 0.62
36 0.52
37 0.43
38 0.33
39 0.23
40 0.17
41 0.1
42 0.08
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.05
50 0.05
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.11
57 0.12
58 0.15
59 0.15
60 0.16
61 0.17
62 0.23
63 0.25
64 0.27
65 0.28
66 0.29
67 0.36
68 0.36
69 0.38
70 0.32
71 0.35
72 0.38
73 0.36
74 0.33
75 0.28
76 0.28
77 0.25
78 0.26
79 0.21
80 0.15
81 0.15
82 0.17
83 0.18
84 0.16
85 0.18
86 0.18
87 0.18
88 0.17
89 0.17
90 0.15
91 0.16
92 0.25
93 0.25
94 0.28
95 0.27
96 0.28
97 0.28
98 0.28
99 0.24
100 0.19
101 0.19
102 0.19
103 0.25