Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YQB4

Protein Details
Accession C7YQB4   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-119IQAIKAKREKKEEKERYEKMAEKMHRKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
22-115RKNGKQWHAPKKAFRPTAGLKSYEKRSQERALLAQIKAKEKEMKDEKEQLRQERIQAIKAKREKKEEKERYEKMAEKMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG nhe:NECHADRAFT_79045  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSDTASPVPEPAPQTEKPQGMRKNGKQWHAPKKAFRPTAGLKSYEKRSQERALLAQIKAKEKEMKDEKEQLRQERIQAIKAKREKKEEKERYEKMAEKMHRKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.42
4 0.44
5 0.51
6 0.53
7 0.57
8 0.66
9 0.65
10 0.69
11 0.71
12 0.71
13 0.71
14 0.74
15 0.75
16 0.75
17 0.74
18 0.72
19 0.75
20 0.79
21 0.73
22 0.64
23 0.61
24 0.56
25 0.59
26 0.53
27 0.47
28 0.4
29 0.42
30 0.47
31 0.44
32 0.42
33 0.37
34 0.4
35 0.4
36 0.41
37 0.38
38 0.34
39 0.35
40 0.35
41 0.31
42 0.29
43 0.28
44 0.28
45 0.26
46 0.27
47 0.26
48 0.22
49 0.31
50 0.35
51 0.36
52 0.37
53 0.46
54 0.46
55 0.5
56 0.54
57 0.49
58 0.49
59 0.46
60 0.43
61 0.41
62 0.4
63 0.37
64 0.4
65 0.39
66 0.42
67 0.49
68 0.54
69 0.53
70 0.62
71 0.65
72 0.67
73 0.75
74 0.76
75 0.78
76 0.8
77 0.78
78 0.75
79 0.74
80 0.69
81 0.63
82 0.62
83 0.6
84 0.6
85 0.66
86 0.69
87 0.7
88 0.69
89 0.74
90 0.76
91 0.8
92 0.8
93 0.82
94 0.83
95 0.85
96 0.92
97 0.93
98 0.93
99 0.93