Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7MN98

Protein Details
Accession A0A1B7MN98    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-76IPPTTYPVPKRPRRLVQGYEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, extr 5, mito 4, E.R. 3, vacu 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
Gene Ontology GO:0016020  C:membrane  
CDD cd22903  NI9M  
Amino Acid Sequences MATLFSPFRRGYRHLQYLAHEQPVIFYSCVLGLAGPVLALTVPAVRRTWFGYTPAEIPPTTYPVPKRPRRLVQGYEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.53
4 0.56
5 0.55
6 0.48
7 0.39
8 0.3
9 0.27
10 0.26
11 0.24
12 0.15
13 0.11
14 0.09
15 0.09
16 0.09
17 0.08
18 0.06
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.04
29 0.04
30 0.06
31 0.07
32 0.07
33 0.09
34 0.12
35 0.15
36 0.15
37 0.17
38 0.19
39 0.2
40 0.22
41 0.22
42 0.22
43 0.18
44 0.2
45 0.19
46 0.21
47 0.21
48 0.24
49 0.26
50 0.34
51 0.44
52 0.5
53 0.59
54 0.63
55 0.72
56 0.76
57 0.81
58 0.79