Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7N1U5

Protein Details
Accession A0A1B7N1U5   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-33NEEENARSKRAKKPRTREPSWSHIVHydrophilic
NLS Segment(s)
PositionSequence
15-24RSKRAKKPRT
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MYLLSVSSNEEENARSKRAKKPRTREPSWSHIVSPDARQPLLASSQITDSTHKVKTRQPSESRLSAASGFKASSSSLDNDNEISTASVETAATSVSLSIPAARKCKPSVQVQKEETKPKPVRRDLGVQSISAAVMMKSPRYPLLRKLTHPHHRNISHC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.35
4 0.44
5 0.54
6 0.63
7 0.68
8 0.74
9 0.81
10 0.85
11 0.86
12 0.86
13 0.82
14 0.8
15 0.76
16 0.68
17 0.58
18 0.5
19 0.47
20 0.39
21 0.35
22 0.32
23 0.28
24 0.26
25 0.25
26 0.23
27 0.21
28 0.22
29 0.2
30 0.14
31 0.12
32 0.13
33 0.15
34 0.15
35 0.15
36 0.15
37 0.18
38 0.22
39 0.23
40 0.25
41 0.29
42 0.37
43 0.42
44 0.49
45 0.49
46 0.52
47 0.55
48 0.55
49 0.52
50 0.42
51 0.37
52 0.3
53 0.26
54 0.2
55 0.15
56 0.12
57 0.1
58 0.1
59 0.09
60 0.08
61 0.09
62 0.09
63 0.11
64 0.11
65 0.12
66 0.12
67 0.12
68 0.1
69 0.09
70 0.07
71 0.05
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.04
84 0.04
85 0.06
86 0.1
87 0.14
88 0.17
89 0.19
90 0.23
91 0.25
92 0.31
93 0.34
94 0.4
95 0.48
96 0.53
97 0.6
98 0.61
99 0.67
100 0.67
101 0.71
102 0.63
103 0.63
104 0.62
105 0.62
106 0.67
107 0.66
108 0.65
109 0.61
110 0.67
111 0.61
112 0.63
113 0.56
114 0.46
115 0.4
116 0.35
117 0.3
118 0.21
119 0.17
120 0.07
121 0.09
122 0.1
123 0.11
124 0.12
125 0.14
126 0.2
127 0.25
128 0.29
129 0.35
130 0.44
131 0.49
132 0.54
133 0.62
134 0.66
135 0.71
136 0.74
137 0.74
138 0.73