Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NAI4

Protein Details
Accession A0A1B7NAI4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-105GKQSCMFRCRRPQKNASNEGRPLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 8, plas 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MLLVEFLRLVLAVLLHSMCRSHHALGLRFLRLRYLRSCIEFMLSPMAICIVAEHCAPQLNDDYSILRLSSQSFLYLNKVDSNGKQSCMFRCRRPQKNASNEGRPLVHMIVRPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.07
6 0.12
7 0.15
8 0.15
9 0.18
10 0.24
11 0.26
12 0.33
13 0.37
14 0.36
15 0.35
16 0.33
17 0.36
18 0.32
19 0.33
20 0.29
21 0.3
22 0.29
23 0.3
24 0.31
25 0.25
26 0.25
27 0.22
28 0.2
29 0.18
30 0.15
31 0.11
32 0.1
33 0.1
34 0.07
35 0.07
36 0.07
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.08
43 0.08
44 0.09
45 0.1
46 0.1
47 0.11
48 0.11
49 0.11
50 0.1
51 0.1
52 0.09
53 0.07
54 0.07
55 0.08
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.13
62 0.14
63 0.14
64 0.14
65 0.16
66 0.16
67 0.18
68 0.24
69 0.22
70 0.23
71 0.27
72 0.28
73 0.32
74 0.39
75 0.43
76 0.44
77 0.53
78 0.62
79 0.67
80 0.74
81 0.78
82 0.8
83 0.85
84 0.87
85 0.84
86 0.82
87 0.75
88 0.7
89 0.61
90 0.52
91 0.45
92 0.37
93 0.32
94 0.25