Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NBW7

Protein Details
Accession A0A1B7NBW7   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-46AVKIPIVKKRTKHFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-48KKRTKHFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQL
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIPIVKKRTKHFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLAMPKIGYGSNKKTRHLLPNGLKKFLVSNVKEVDLLLMHNKSFAAEIAHNVSSRNRNIILERAKALGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.89
4 0.92
5 0.91
6 0.9
7 0.88
8 0.86
9 0.83
10 0.76
11 0.66
12 0.62
13 0.6
14 0.59
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.7
31 0.66
32 0.64
33 0.59
34 0.59
35 0.58
36 0.58
37 0.51
38 0.44
39 0.39
40 0.31
41 0.27
42 0.22
43 0.24
44 0.31
45 0.33
46 0.34
47 0.38
48 0.4
49 0.45
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.47
57 0.4
58 0.36
59 0.32
60 0.32
61 0.22
62 0.25
63 0.25
64 0.26
65 0.25
66 0.24
67 0.2
68 0.12
69 0.12
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.17
85 0.21
86 0.23
87 0.24
88 0.26
89 0.24
90 0.25
91 0.27
92 0.35
93 0.37
94 0.34
95 0.35
96 0.32
97 0.31
98 0.3
99 0.28
100 0.24
101 0.2
102 0.18
103 0.21
104 0.25
105 0.26
106 0.27
107 0.31
108 0.28