Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7N7W3

Protein Details
Accession A0A1B7N7W3   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-124ELMPKQKRTETKKFKKYYYKPLNKISRWESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 5.5, cyto_mito 5, mito 3.5
Family & Domain DBs
Amino Acid Sequences EFTGMLVEALATSRASSMDPFALHSALIQTHPHLDTKYNKKQWLKVIPAVLEAGRVRCGMFEKVHSSGTNGEKQARWFYLSEKDEDRERAGLLEELMPKQKRTETKKFKKYYYKPLNKISRWESEDAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.12
6 0.12
7 0.14
8 0.15
9 0.15
10 0.14
11 0.13
12 0.13
13 0.11
14 0.12
15 0.11
16 0.1
17 0.13
18 0.14
19 0.16
20 0.15
21 0.19
22 0.27
23 0.36
24 0.45
25 0.49
26 0.55
27 0.58
28 0.63
29 0.67
30 0.67
31 0.63
32 0.57
33 0.54
34 0.47
35 0.43
36 0.38
37 0.29
38 0.22
39 0.17
40 0.13
41 0.11
42 0.1
43 0.09
44 0.09
45 0.11
46 0.12
47 0.12
48 0.13
49 0.15
50 0.17
51 0.18
52 0.18
53 0.17
54 0.19
55 0.21
56 0.23
57 0.21
58 0.21
59 0.21
60 0.23
61 0.25
62 0.21
63 0.2
64 0.17
65 0.18
66 0.25
67 0.25
68 0.26
69 0.25
70 0.27
71 0.28
72 0.29
73 0.28
74 0.2
75 0.19
76 0.17
77 0.16
78 0.14
79 0.12
80 0.14
81 0.14
82 0.15
83 0.21
84 0.22
85 0.22
86 0.24
87 0.29
88 0.34
89 0.41
90 0.51
91 0.56
92 0.65
93 0.75
94 0.8
95 0.84
96 0.86
97 0.86
98 0.86
99 0.86
100 0.86
101 0.83
102 0.86
103 0.88
104 0.8
105 0.8
106 0.75
107 0.73
108 0.67