Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7MFN2

Protein Details
Accession A0A1B7MFN2    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-110ASLQQSCERKWERRREKDSRRDTIDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MNIVPPYLHLSDVKIKLFVSTWYDSSQVLVPTTSTGTRIASSVDAEWAFSGGRLQVNHPQHGIRPSRHRSPSDLGSTHPLCPISASLQQSCERKWERRREKDSRRDTIDVDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.26
4 0.26
5 0.24
6 0.21
7 0.2
8 0.21
9 0.21
10 0.22
11 0.21
12 0.21
13 0.21
14 0.16
15 0.14
16 0.12
17 0.11
18 0.11
19 0.13
20 0.11
21 0.1
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.09
30 0.1
31 0.09
32 0.09
33 0.08
34 0.08
35 0.07
36 0.06
37 0.06
38 0.05
39 0.07
40 0.07
41 0.09
42 0.16
43 0.19
44 0.2
45 0.21
46 0.2
47 0.2
48 0.27
49 0.29
50 0.26
51 0.33
52 0.38
53 0.46
54 0.51
55 0.51
56 0.49
57 0.5
58 0.51
59 0.48
60 0.43
61 0.36
62 0.38
63 0.38
64 0.33
65 0.3
66 0.24
67 0.18
68 0.18
69 0.18
70 0.15
71 0.19
72 0.21
73 0.21
74 0.24
75 0.29
76 0.31
77 0.31
78 0.36
79 0.37
80 0.43
81 0.52
82 0.59
83 0.66
84 0.74
85 0.83
86 0.85
87 0.9
88 0.92
89 0.92
90 0.9
91 0.86
92 0.79