Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MVE0

Protein Details
Accession A0A1B7MVE0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-74RKATRVRWECLRRKSPRYARLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002156  RNaseH_domain  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences PGHSDVHGNEEADKQAKLAAKSRRNNSLPAELLHYLRHGAFPLSISALKEVHRKATRVRWECLRRKSPRYARLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.2
4 0.21
5 0.26
6 0.33
7 0.41
8 0.49
9 0.54
10 0.59
11 0.58
12 0.6
13 0.56
14 0.53
15 0.46
16 0.38
17 0.38
18 0.29
19 0.28
20 0.24
21 0.2
22 0.14
23 0.13
24 0.12
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.09
32 0.09
33 0.1
34 0.11
35 0.12
36 0.17
37 0.18
38 0.25
39 0.28
40 0.3
41 0.35
42 0.43
43 0.52
44 0.52
45 0.56
46 0.57
47 0.64
48 0.72
49 0.76
50 0.77
51 0.75
52 0.77
53 0.84
54 0.83