Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7MJY6

Protein Details
Accession A0A1B7MJY6    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-44TKHFREPSKDRCKNRSKRQIGCTSELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 9, mito 8, cyto 3, pero 3
Family & Domain DBs
Amino Acid Sequences MFKAQLPVITDPVSFIIVTKHFREPSKDRCKNRSKRQIGCTSELRARVARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.13
5 0.16
6 0.18
7 0.22
8 0.24
9 0.25
10 0.32
11 0.35
12 0.43
13 0.52
14 0.57
15 0.59
16 0.65
17 0.75
18 0.79
19 0.84
20 0.84
21 0.82
22 0.82
23 0.86
24 0.86
25 0.81
26 0.76
27 0.7
28 0.65
29 0.6
30 0.54
31 0.48