Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7MSK2

Protein Details
Accession A0A1B7MSK2   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
213-242LHPSKRALRNSIRKTGKKKSLKWVKEHGLEHydrophilic
NLS Segment(s)
PositionSequence
216-234SKRALRNSIRKTGKKKSLK
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MAHTPDTNSSVDIISTPSWSATDSEDDEVVWGISGESSSESSLSDYVLLPRTGTVRHVASTHDSDSDDSASETGLSLPFDLLSITTSSKADDESHTKQAQQKLSPGKRKAKGASSIEDPSSTPRSNSGAATPISSYEDASAFITRHLNSPTKEGRTSAKLQLLQAFVVELGASQHVPTSLTSARKLLKAEAHINIQEYVAVRGKDQGALREILHPSKRALRNSIRKTGKKKSLKWVKEHGLEVFLIGCYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.11
5 0.11
6 0.12
7 0.13
8 0.12
9 0.16
10 0.17
11 0.18
12 0.18
13 0.18
14 0.17
15 0.16
16 0.14
17 0.09
18 0.07
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.07
25 0.07
26 0.07
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.08
33 0.11
34 0.14
35 0.14
36 0.13
37 0.14
38 0.15
39 0.15
40 0.16
41 0.17
42 0.15
43 0.16
44 0.17
45 0.18
46 0.21
47 0.24
48 0.23
49 0.21
50 0.2
51 0.19
52 0.2
53 0.18
54 0.14
55 0.11
56 0.1
57 0.08
58 0.07
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.06
71 0.07
72 0.08
73 0.08
74 0.08
75 0.09
76 0.1
77 0.1
78 0.12
79 0.18
80 0.21
81 0.27
82 0.27
83 0.29
84 0.33
85 0.38
86 0.39
87 0.35
88 0.37
89 0.41
90 0.49
91 0.56
92 0.59
93 0.62
94 0.62
95 0.65
96 0.63
97 0.58
98 0.58
99 0.52
100 0.47
101 0.42
102 0.4
103 0.34
104 0.31
105 0.26
106 0.21
107 0.22
108 0.19
109 0.15
110 0.15
111 0.16
112 0.17
113 0.17
114 0.15
115 0.14
116 0.14
117 0.14
118 0.13
119 0.11
120 0.12
121 0.11
122 0.11
123 0.08
124 0.08
125 0.08
126 0.09
127 0.09
128 0.07
129 0.08
130 0.11
131 0.1
132 0.13
133 0.15
134 0.18
135 0.18
136 0.24
137 0.28
138 0.3
139 0.3
140 0.29
141 0.3
142 0.31
143 0.34
144 0.33
145 0.33
146 0.31
147 0.32
148 0.34
149 0.31
150 0.26
151 0.22
152 0.17
153 0.11
154 0.1
155 0.08
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.06
164 0.06
165 0.1
166 0.13
167 0.16
168 0.17
169 0.21
170 0.23
171 0.25
172 0.27
173 0.26
174 0.26
175 0.29
176 0.33
177 0.32
178 0.34
179 0.32
180 0.33
181 0.3
182 0.25
183 0.21
184 0.17
185 0.17
186 0.17
187 0.16
188 0.15
189 0.18
190 0.19
191 0.22
192 0.23
193 0.23
194 0.22
195 0.24
196 0.24
197 0.26
198 0.28
199 0.31
200 0.33
201 0.31
202 0.31
203 0.39
204 0.45
205 0.44
206 0.5
207 0.54
208 0.62
209 0.68
210 0.75
211 0.75
212 0.77
213 0.81
214 0.83
215 0.83
216 0.82
217 0.82
218 0.83
219 0.84
220 0.84
221 0.83
222 0.83
223 0.82
224 0.78
225 0.74
226 0.65
227 0.56
228 0.48
229 0.4
230 0.31