Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7N892

Protein Details
Accession A0A1B7N892   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
247-271DWKPNLFSKPRCRHTQSLRLRLRLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021950  Spt20  
IPR046468  Spt20-like_SEP  
Gene Ontology GO:0000124  C:SAGA complex  
GO:0003712  F:transcription coregulator activity  
Pfam View protein in Pfam  
PF12090  Spt20  
Amino Acid Sequences MSCYNVTRSAEQLLEVYDDAIPSFSLHLHPDYWTLNNGPKFLYNNPVASLLDDVRAHRIPVDYLELFDTARVPFYDGCMLVELLDYRPKRVKDPPLENPERSRVALHPNDETLWANLCLMNQHSGNKFTDSDVLDLEAQILLHTAPPLCLDPDPHLTRIVNHTLRVSTPSIPVSLKRKAAAITPEEDESEKARRGKIMQFMNPRPTRSHSPRYSIMCKNKLFPAHLHLVIGYWKPFAVPRKFAGRLDWKPNLFSKPRCRHTQSLRLRLRLRLKLRPSVNHIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.15
4 0.11
5 0.11
6 0.1
7 0.1
8 0.09
9 0.07
10 0.08
11 0.08
12 0.09
13 0.12
14 0.14
15 0.14
16 0.15
17 0.18
18 0.2
19 0.2
20 0.21
21 0.22
22 0.27
23 0.28
24 0.28
25 0.26
26 0.27
27 0.29
28 0.29
29 0.33
30 0.29
31 0.28
32 0.29
33 0.3
34 0.26
35 0.23
36 0.24
37 0.17
38 0.17
39 0.17
40 0.16
41 0.19
42 0.2
43 0.19
44 0.18
45 0.19
46 0.16
47 0.17
48 0.22
49 0.17
50 0.17
51 0.18
52 0.17
53 0.16
54 0.15
55 0.14
56 0.08
57 0.1
58 0.09
59 0.1
60 0.09
61 0.12
62 0.14
63 0.13
64 0.14
65 0.13
66 0.13
67 0.11
68 0.12
69 0.1
70 0.09
71 0.15
72 0.15
73 0.17
74 0.23
75 0.24
76 0.28
77 0.35
78 0.43
79 0.47
80 0.55
81 0.62
82 0.66
83 0.71
84 0.69
85 0.64
86 0.6
87 0.52
88 0.44
89 0.36
90 0.28
91 0.31
92 0.32
93 0.31
94 0.27
95 0.26
96 0.25
97 0.25
98 0.23
99 0.16
100 0.13
101 0.11
102 0.1
103 0.1
104 0.09
105 0.09
106 0.09
107 0.11
108 0.1
109 0.13
110 0.14
111 0.16
112 0.17
113 0.18
114 0.17
115 0.16
116 0.19
117 0.16
118 0.16
119 0.13
120 0.13
121 0.11
122 0.11
123 0.1
124 0.06
125 0.05
126 0.04
127 0.04
128 0.03
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.06
136 0.06
137 0.07
138 0.1
139 0.17
140 0.19
141 0.19
142 0.2
143 0.2
144 0.21
145 0.24
146 0.28
147 0.23
148 0.22
149 0.22
150 0.21
151 0.21
152 0.23
153 0.21
154 0.14
155 0.15
156 0.15
157 0.15
158 0.16
159 0.19
160 0.21
161 0.24
162 0.25
163 0.24
164 0.25
165 0.24
166 0.27
167 0.28
168 0.25
169 0.23
170 0.22
171 0.22
172 0.21
173 0.21
174 0.19
175 0.16
176 0.18
177 0.19
178 0.2
179 0.2
180 0.22
181 0.25
182 0.29
183 0.34
184 0.38
185 0.41
186 0.49
187 0.53
188 0.61
189 0.6
190 0.57
191 0.53
192 0.52
193 0.54
194 0.53
195 0.58
196 0.53
197 0.56
198 0.61
199 0.64
200 0.66
201 0.65
202 0.67
203 0.65
204 0.61
205 0.59
206 0.57
207 0.54
208 0.5
209 0.43
210 0.4
211 0.38
212 0.36
213 0.33
214 0.27
215 0.24
216 0.25
217 0.24
218 0.18
219 0.13
220 0.12
221 0.12
222 0.17
223 0.25
224 0.28
225 0.31
226 0.34
227 0.43
228 0.47
229 0.47
230 0.51
231 0.53
232 0.54
233 0.58
234 0.62
235 0.55
236 0.55
237 0.59
238 0.58
239 0.56
240 0.57
241 0.59
242 0.62
243 0.68
244 0.74
245 0.76
246 0.78
247 0.8
248 0.82
249 0.82
250 0.82
251 0.83
252 0.82
253 0.79
254 0.78
255 0.77
256 0.76
257 0.73
258 0.73
259 0.71
260 0.72
261 0.76
262 0.75