Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z1X3

Protein Details
Accession C7Z1X3   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-40KNRLAARASKAKKERRKRSLAPKDKIAKABasic
NLS Segment(s)
PositionSequence
10-79PSKNRLAARASKAKKERRKRSLAPKDKIAKADATRGARAGLLPTSGPRAKVSGKRARKLEKKMGYALKRK
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
KEGG nhe:NECHADRAFT_85948  -  
Amino Acid Sequences MPSVKNPNGPSKNRLAARASKAKKERRKRSLAPKDKIAKADATRGARAGLLPTSGPRAKVSGKRARKLEKKMGYALKRKQEAEGEAEMKDAPVENEGGDKVEEVVMGDIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.54
3 0.53
4 0.57
5 0.62
6 0.58
7 0.59
8 0.65
9 0.71
10 0.76
11 0.79
12 0.81
13 0.81
14 0.86
15 0.86
16 0.89
17 0.9
18 0.9
19 0.84
20 0.83
21 0.81
22 0.75
23 0.68
24 0.58
25 0.52
26 0.43
27 0.43
28 0.39
29 0.34
30 0.31
31 0.29
32 0.27
33 0.22
34 0.2
35 0.15
36 0.09
37 0.07
38 0.07
39 0.07
40 0.11
41 0.11
42 0.12
43 0.11
44 0.13
45 0.17
46 0.23
47 0.31
48 0.37
49 0.44
50 0.49
51 0.55
52 0.63
53 0.67
54 0.69
55 0.71
56 0.68
57 0.65
58 0.66
59 0.68
60 0.66
61 0.67
62 0.66
63 0.64
64 0.61
65 0.58
66 0.54
67 0.5
68 0.45
69 0.41
70 0.39
71 0.32
72 0.27
73 0.27
74 0.23
75 0.19
76 0.17
77 0.12
78 0.08
79 0.07
80 0.08
81 0.07
82 0.09
83 0.1
84 0.11
85 0.1
86 0.1
87 0.1
88 0.09
89 0.09
90 0.08