Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NFI6

Protein Details
Accession A0A1B7NFI6   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-53EASPAKRGRGRPKGSKNKKSGGBasic
59-102ATDAGTKRKRGRPPKEKKEEAVDGEPPTKRKRGRPPKAKAEAPTBasic
NLS Segment(s)
PositionSequence
35-98PAKRGRGRPKGSKNKKSGGTSATAATDAGTKRKRGRPPKEKKEEAVDGEPPTKRKRGRPPKAKA
117-128TKRKRGRPPKKT
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSTSPQQEEVRDKSQEELEEEQQVDENEGAAEASPAKRGRGRPKGSKNKKSGGTSATAATDAGTKRKRGRPPKEKKEEAVDGEPPTKRKRGRPPKAKAEAPTSTTSEPAPDAAESSTKRKRGRPPKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.34
4 0.33
5 0.29
6 0.31
7 0.31
8 0.28
9 0.25
10 0.23
11 0.2
12 0.15
13 0.12
14 0.08
15 0.08
16 0.07
17 0.05
18 0.06
19 0.06
20 0.06
21 0.11
22 0.12
23 0.14
24 0.19
25 0.26
26 0.36
27 0.45
28 0.52
29 0.58
30 0.68
31 0.78
32 0.84
33 0.87
34 0.83
35 0.8
36 0.79
37 0.72
38 0.64
39 0.55
40 0.47
41 0.39
42 0.33
43 0.26
44 0.19
45 0.16
46 0.12
47 0.12
48 0.1
49 0.14
50 0.16
51 0.18
52 0.24
53 0.32
54 0.41
55 0.49
56 0.6
57 0.65
58 0.74
59 0.82
60 0.86
61 0.83
62 0.77
63 0.74
64 0.68
65 0.61
66 0.53
67 0.45
68 0.36
69 0.36
70 0.35
71 0.31
72 0.3
73 0.33
74 0.34
75 0.4
76 0.49
77 0.57
78 0.66
79 0.74
80 0.8
81 0.84
82 0.88
83 0.84
84 0.77
85 0.73
86 0.67
87 0.6
88 0.54
89 0.47
90 0.39
91 0.35
92 0.3
93 0.24
94 0.2
95 0.17
96 0.15
97 0.11
98 0.11
99 0.12
100 0.17
101 0.18
102 0.26
103 0.33
104 0.39
105 0.44
106 0.51
107 0.61
108 0.67