Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7MWD4

Protein Details
Accession A0A1B7MWD4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-52VLDKRLRKRLRTRSKTVCGTRHydrophilic
NLS Segment(s)
PositionSequence
38-41RKRL
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 4
Family & Domain DBs
Amino Acid Sequences MVTAIEEELFEHEPRILLDHCFQGEHSSECEVLDKRLRKRLRTRSKTVCGTRYRVPMRMRMRRTKGWSAKANLSVVGVRQSAKCNCRWMWGQLDIAGRCTVKGDWTEIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.14
4 0.14
5 0.16
6 0.19
7 0.19
8 0.19
9 0.19
10 0.18
11 0.19
12 0.18
13 0.17
14 0.15
15 0.15
16 0.14
17 0.18
18 0.15
19 0.17
20 0.23
21 0.28
22 0.31
23 0.4
24 0.45
25 0.49
26 0.59
27 0.67
28 0.71
29 0.73
30 0.77
31 0.78
32 0.81
33 0.82
34 0.76
35 0.73
36 0.65
37 0.61
38 0.57
39 0.56
40 0.51
41 0.48
42 0.45
43 0.46
44 0.51
45 0.56
46 0.58
47 0.58
48 0.62
49 0.63
50 0.68
51 0.7
52 0.68
53 0.67
54 0.67
55 0.62
56 0.61
57 0.57
58 0.5
59 0.4
60 0.34
61 0.26
62 0.2
63 0.18
64 0.14
65 0.12
66 0.13
67 0.19
68 0.24
69 0.27
70 0.3
71 0.34
72 0.34
73 0.38
74 0.4
75 0.39
76 0.39
77 0.39
78 0.37
79 0.35
80 0.41
81 0.35
82 0.34
83 0.32
84 0.26
85 0.22
86 0.23
87 0.19
88 0.16
89 0.18